GenePage for the glnU gene of Escherichia coli K-12

Primary Gene Name: glnU
EcoGene Accession Number: EG30028
K-12 Gene Accession Number: ECK0659
MG1655 Gene Identifier: b0670
Gene Name Mnemonic: Glutamine
Alternate Gene Symbols: glnUalpha; supB
Description: Glutamine tRNA(UUG) 1
  # bp Upstream # bp Downstream
MW: 24265.41 ---------75 nt Pre-Run BlastN
Left End: 696865
Left Intergenic Region

Name: glnW_glnU

Length: 34 bp gap

Orientation: Codirectional-

Left_end: 696831

Right_end: 696864

Centisome: 15.01

Genomic Address
Counterclockwise
Minute or Centisome (%) = 15.01
Right End: 696939
Right Intergenic Region

Name: glnU_leuW

Length: 23 bp gap

Orientation: Codirectional-

Left_end: 696940

Right_end: 696962

Centisome: 15.01

A putative small 39 aa protein designated b0669, MNRLLEEDGWGTWIRTRECRYQKPVPYRLAIPHPYNAFW, was originally annotated as complementary to glnU; b0669 was later eliminated from the genome annotations as being an unlikely gene product with no evidence of protein conservation. However an RNA transcript complementary to glnU detectable only in an RNase P deficient strain was found using microarrays and confirmed with a Northern blot (Li, 2003). The nature, length, and start site of this b0669 transcript is not known: it may be a novel sRNA, it may encode a small protein, it may be a ubiF readthrough transcript, or it might represent a spurious non-physiological transcription event due to the rpesence of an accidental promoter.

Go to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePage

BamHI EcoRI HindIII