GenePage for the ybfK gene of Escherichia coli K-12

Primary Gene Name: ybfK
EcoGene Accession Number: EG12869
K-12 Gene Accession Number: ECK4400
MG1655 Gene Identifier: b4590
Gene Name Mnemonic: Systematic nomenclature
Alternate Gene Symbols: None
Description: Uncharacterized protein, function unknown
  # bp Upstream # bp Downstream
MW: 9499.05 ---------85 aa Pre-Run BlastP UniProt
Pre-Run BlastP NR+Env
Left End: 720583
Left Intergenic Region

Name: speF_ybfK

Length: 122 bp gap

Orientation: Divergent

Left_end: 720461

Right_end: 720582

Centisome: 15.52

Genomic Address
Clockwise
Minute or Centisome (%) = 15.52
Right End: 720840
Right Intergenic Region

Name: ybfK_kdpE

Length: 215 bp gap

Orientation: Convergent

Left_end: 720841

Right_end: 721055

Centisome: 15.53

A full length YbfK homolog can be found in the bacterial genome of Enterobacter cloacae SCF1, although it is unannotated: MSQTPPVRLLAMSRICQGERCWLQANACTSKIQEDLYAKAPVVGRLPGIKEVKVKTIAVGKHHDVCCPPYVGHSSAVVFHFVYL.

Go to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePageGo to GenePage

BamHI EcoRI HindIII