BLAST Search Results

Blast performed on February-4-2012 BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: nr_env 20,512,688 sequences; 6,167,035,527 total letters Query= EG14302 hokE Length=50 Score E Sequences producing significant alignments: (Bits) Value dbj|BAI54052.1| conserved hypothetical protein [Escherichia coli... 101 5e-20 ref|YP_001879244.1| Hok/Gef family protein [Shigella boydii CDC ... 101 5e-20 ref|YP_001457392.1| Hok/Gef family protein [Escherichia coli HS]... 101 5e-20 ref|YP_002328055.1| regulatory protein MokC for HokC 2 [Escheric... 101 6e-20 gb|EGB54535.1| hok/gef family protein [Escherichia coli H489] 100 7e-20 ref|YP_001879242.1| Hok/Gef family protein [Shigella boydii CDC ... 100 8e-20 ref|ZP_07146007.1| Hok/gef family protein [Escherichia coli MS 1... 100 9e-20 ref|ZP_07222092.1| Hok/gef family protein [Escherichia coli MS 7... 100 1e-19 ref|ZP_07143056.1| Hok/gef family protein [Escherichia coli MS 1... 100 1e-19 ref|YP_025295.1| toxic polypeptide, small [Escherichia coli str.... 99.8 1e-19 ref|ZP_08372876.1| conserved domain protein [Escherichia coli TA... 99.8 1e-19 ref|YP_001879248.1| Hok/Gef family protein [Shigella boydii CDC ... 99.4 2e-19 ref|NP_836210.1| hypothetical protein S0500 [Shigella flexneri 2... 99.4 2e-19 ref|YP_002383633.1| small toxic membrane polypeptide, HokE-like ... 99.4 2e-19 ref|NP_286308.1| hypothetical protein Z0722 [Escherichia coli O1... 99.4 2e-19 ref|ZP_07154320.1| Hok/gef family protein [Escherichia coli MS 2... 99.4 2e-19 ref|YP_002291921.1| hypothetical protein ECSE_0646 [Escherichia ... 98.6 3e-19 ref|YP_668540.1| hypothetical protein ECP_0613 [Escherichia coli... 98.6 3e-19 ref|ZP_03031064.1| Hok/Gef family protein [Escherichia coli B7A]... 98.2 4e-19 ref|ZP_02804074.1| Hok/Gef family protein [Escherichia coli O157... 98.2 4e-19 ref|ZP_08352607.1| conserved domain protein [Escherichia coli M7... 97.8 5e-19 gb|EFX27672.1| Hok/Gef family protein [Escherichia coli O55:H7 s... 97.4 7e-19 gb|EGB62945.1| hok/gef family protein [Escherichia coli M863] >g... 97.4 7e-19 gb|EFX22405.1| Hok/Gef family protein [Escherichia coli O55:H7 s... 97.1 8e-19 ref|ZP_08362868.1| conserved domain protein [Escherichia coli TA... 97.1 1e-18 gb|EGB62943.1| hok/gef family protein [Escherichia coli M863] >g... 97.1 1e-18 ref|NP_286307.1| hypothetical protein Z0721 [Escherichia coli O1... 96.7 1e-18 ref|ZP_07680615.1| hok/gef family protein [Shigella dysenteriae ... 96.7 1e-18 gb|EFZ44749.1| hok/gef family protein [Escherichia coli E128010] 95.9 2e-18 gb|EFU50703.1| Hok/gef family protein [Escherichia coli MS 153-1] 95.9 2e-18 ref|NP_836209.1| hypothetical protein S0499 [Shigella flexneri 2... 95.9 2e-18 gb|EFX27568.1| Hok/Gef family protein [Escherichia coli O55:H7 s... 95.5 3e-18 ref|ZP_07188882.1| Hok/gef family protein [Escherichia coli MS 6... 95.5 3e-18 gb|EGB62944.1| hok/gef family protein [Escherichia coli M863] >g... 95.5 3e-18 ref|ZP_06652546.1| conserved hypothetical protein [Escherichia c... 95.1 3e-18 ref|ZP_02902179.1| Hok/Gef family protein [Escherichia albertii ... 95.1 4e-18 ref|NP_308647.1| hypothetical protein ECs0620 [Escherichia coli ... 94.7 4e-18 gb|EFX31969.1| Hok/Gef family protein [Escherichia coli O157:H7 ... 94.0 8e-18 ref|YP_003364210.1| host cell-killing modulation protein [Citrob... 91.7 4e-17 ref|YP_001336726.1| small toxic membrane polypeptide [Klebsiella... 85.9 2e-15 ref|YP_002236897.1| Hok/Gef family protein [Klebsiella pneumonia... 85.5 3e-15 ref|YP_003500907.1| Small toxic membrane polypeptide [Escherichi... 84.7 5e-15 ref|YP_001881499.1| hok/gef family protein [Shigella boydii CDC ... 84.7 5e-15 ref|YP_002920949.1| small toxic membrane polypeptide [Klebsiella... 84.0 8e-15 ref|ZP_07115210.1| Hok/gef family protein [Escherichia coli MS 1... 84.0 8e-15 ref|NP_289311.1| hypothetical protein Z4071 [Escherichia coli O1... 84.0 9e-15 ref|YP_003940501.1| Hok/gef cell toxic protein [Enterobacter clo... 80.5 8e-14 gb|EFZ49828.1| hok/gef family protein [Shigella sonnei 53G] >gb|... 79.0 2e-13 ref|ZP_08306187.1| Hok/gef family protein [Klebsiella sp. MS 92-... 72.4 2e-11 ref|ZP_07222091.1| Hok/gef family protein [Escherichia coli MS 7... 70.9 7e-11 ref|ZP_07143057.1| Hok/gef family protein [Escherichia coli MS 1... 70.5 1e-10 ref|ZP_02900778.1| conserved domain protein [Escherichia alberti... 66.2 2e-09 ref|YP_001144366.1| hypothetical protein ASA_P5G151 [Aeromonas s... 55.5 3e-06 gb|ADA75900.1| putative membrane permeability altering protein [... 49.7 2e-04 ref|YP_001812480.1| post-segregation killing protein [Proteus mi... 48.9 3e-04 ref|ZP_08350474.1| conserved domain protein [Escherichia coli M6... 47.8 7e-04 ref|YP_003367662.1| small toxic membrane protein HokA [Citrobact... 47.4 8e-04 ref|ZP_07143768.1| Hok/gef family protein [Escherichia coli MS 1... 46.2 0.002 ref|ZP_07164784.1| Hok/gef family protein [Escherichia coli MS 1... 46.2 0.002 ref|ZP_08303544.1| Hok/gef family protein [Klebsiella sp. MS 92-... 45.8 0.003 ref|ZP_07136872.1| Hok/gef family protein [Escherichia coli MS 1... 45.4 0.003 ref|YP_543057.1| small toxic polypeptide [Escherichia coli UTI89... 45.4 0.003 ref|YP_026229.1| toxic polypeptide, small [Escherichia coli str.... 45.4 0.003 ref|YP_312608.1| small toxic polypeptide [Shigella sonnei Ss046]... 45.4 0.003 ref|ZP_06551228.1| small toxic polypeptide [Klebsiella sp. 1_1_5... 45.1 0.004 ref|YP_003437125.1| Hok/gef cell toxic protein [Klebsiella varii... 45.1 0.005 ref|YP_001144316.1| SrnB protein [Aeromonas salmonicida subsp. s... 45.1 0.005 ref|YP_409869.1| small toxic polypeptide [Shigella boydii Sb227]... 45.1 0.005 ref|ZP_07593915.1| Hok/gef cell toxic protein [Escherichia coli ... 45.1 0.005 ref|ZP_08394538.1| small toxic polypeptide [Shigella sp. D9] >gb... 44.7 0.005 ref|ZP_08385806.1| conserved domain protein [Escherichia coli H2... 44.7 0.005 gb|EFZ68115.1| protein pndA [Escherichia coli 1357] 44.7 0.006 ref|NP_290142.1| small toxic polypeptide [Escherichia coli O157:... 44.7 0.006 ref|ZP_04872797.1| conserved hypothetical protein [Escherichia s... 44.7 0.006 ref|ZP_07172293.1| Hok/gef family protein [Escherichia coli MS 2... 44.7 0.006 ref|YP_001745843.1| small toxic polypeptide [Escherichia coli SM... 44.3 0.007 ref|YP_001465033.1| small toxic polypeptide [Escherichia coli E2... 44.3 0.007 ref|ZP_04621153.1| hypothetical protein yaldo0001_36870 [Yersini... 44.3 0.007 ref|YP_002295106.1| small toxic polypeptide [Escherichia coli SE... 44.3 0.007 ref|YP_001337574.1| small toxic polypeptide [Klebsiella pneumoni... 44.3 0.008 ref|ZP_04627665.1| hypothetical protein yberc0001_14270 [Yersini... 44.3 0.008 ref|ZP_06658909.1| srnB protein [Escherichia coli B185] >gb|EFF0... 43.9 0.009 ref|ZP_03049409.1| protein hokA [Escherichia coli E110019] >ref|... 43.9 0.009 ref|ZP_07104706.1| Hok/gef family protein [Escherichia coli MS 1... 43.9 0.009 ref|NP_061384.1| post-segregation killing protein [Plasmid F] >r... 43.9 0.010 gb|EGB59887.1| hok/gef family protein [Escherichia coli M863] 43.9 0.010 gb|EFZ69370.1| protein pndA [Escherichia coli 1357] 43.9 0.010 ref|ZP_06014679.1| conserved hypothetical protein [Klebsiella pn... 43.9 0.010 ref|YP_001965411.1| Post-segregational killing toxin [Escherichi... 43.9 0.010 ref|NP_061383.1| modulator of post-segregation killing protein [... 43.9 0.010 ref|ZP_06013867.1| conserved hypothetical protein [Klebsiella pn... 43.9 0.010 ref|ZP_06655660.1| small toxic polypeptide [Escherichia coli B35... 43.5 0.012 ref|NP_053109.1| hypothetical protein pB171_047 [Escherichia col... 43.5 0.012 ref|YP_001711926.1| hypothetical protein pVM01_p077 [Escherichia... 43.5 0.012 ref|YP_001816555.1| SrnB [Escherichia coli 1520] >ref|YP_0039376... 43.5 0.012 ref|YP_001481218.1| hypothetical protein APECO1_O1CoBM63 [Escher... 43.5 0.013 ref|ZP_07125337.1| Hok/gef family protein [Escherichia coli MS 8... 43.5 0.014 ref|YP_002236068.1| protein HokA [Klebsiella pneumoniae 342] >gb... 43.1 0.016 ref|ZP_07248314.1| Hok/gef family protein [Escherichia coli MS 1... 43.1 0.016 ref|ZP_08497500.1| hypothetical protein HMPREF9086_1761 [Enterob... 43.1 0.016 ref|YP_003611380.1| small toxic polypeptide [Enterobacter cloaca... 43.1 0.017 ref|ZP_05966793.2| hypothetical protein ENTCAN_05135 [Enterobact... 43.1 0.018 ref|ZP_03001470.1| protein hokA [Escherichia coli 53638] >gb|EDU... 43.1 0.018 gb|EGL73446.1| protein hok [Cronobacter sakazakii E899] 42.7 0.019 ref|ZP_07102183.1| Hok/gef family protein [Escherichia coli MS 1... 42.7 0.020 ref|YP_003501752.1| small toxic polypeptide [Escherichia coli O5... 42.7 0.021 ref|YP_003232548.1| modulator of post-segregation killing protei... 42.7 0.021 ref|YP_308717.1| post-segregation killing protein [Escherichia c... 42.7 0.021 ref|ZP_02901004.1| protein hokA [Escherichia albertii TW07627] >... 42.7 0.022 gb|EGI90261.1| protein pndA [Shigella boydii 5216-82] 42.7 0.024 ref|ZP_08368990.1| conserved domain protein [Escherichia coli TA... 42.4 0.028 ref|YP_405728.1| small toxic polypeptide [Shigella dysenteriae S... 42.4 0.029 ref|ZP_07192234.1| Hok/gef family protein [Escherichia coli MS 1... 42.0 0.032 ref|ZP_05974139.1| conserved domain protein [Providencia rustigi... 42.0 0.032 ref|ZP_03007093.1| conserved domain protein [Escherichia coli O1... 42.0 0.034 ref|YP_003208406.1| protein hok [Cronobacter turicensis z3032] >... 42.0 0.038 ref|ZP_03047599.1| conserved domain protein [Escherichia coli E2... 42.0 0.040 ref|YP_003212427.1| Stable plasmid inheritance protein [Cronobac... 41.6 0.050 ref|NP_941312.1| small toxic polypeptide [Serratia marcescens] >... 41.2 0.067 emb|CBX72613.1| stable plasmid inheritance protein [Yersinia ent... 40.8 0.070 ref|ZP_06015359.1| conserved hypothetical protein [Klebsiella pn... 40.8 0.083 gb|EGL71915.1| Stable plasmid inheritance protein [Cronobacter s... 40.4 0.099 >dbj|BAI54052.1| conserved hypothetical protein [Escherichia coli SE15] Length=98 Score = 101 bits (251), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 49 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 98 >ref|YP_001879244.1| Hok/Gef family protein [Shigella boydii CDC 3083-94] ref|YP_001879246.1| Hok/Gef family protein [Shigella boydii CDC 3083-94] gb|ACD07300.1| Hok/Gef family protein [Shigella boydii CDC 3083-94] gb|ACD10364.1| Hok/Gef family protein [Shigella boydii CDC 3083-94] Length=83 Score = 101 bits (251), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 34 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 83 >ref|YP_001457392.1| Hok/Gef family protein [Escherichia coli HS] ref|ZP_05437670.1| putative small toxic membrane polypeptide, Putative HokE-like protein (partial) [Escherichia sp. 4_1_40B] ref|ZP_07125366.1| Hok/gef family protein [Escherichia coli MS 84-1] 15 more sequence titles Length=83 Score = 101 bits (251), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 34 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 83 >ref|YP_002328055.1| regulatory protein MokC for HokC 2 [Escherichia coli O127:H6 str. E2348/69] emb|CAS08030.1| regulatory protein MokC for HokC 2 [Escherichia coli O127:H6 str. E2348/69] Length=83 Score = 101 bits (251), Expect = 6e-20, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 34 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 83 >gb|EGB54535.1| hok/gef family protein [Escherichia coli H489] Length=73 Score = 100 bits (250), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 24 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 73 >ref|YP_001879242.1| Hok/Gef family protein [Shigella boydii CDC 3083-94] gb|ACD07431.1| Hok/Gef family protein [Shigella boydii CDC 3083-94] Length=62 Score = 100 bits (249), Expect = 8e-20, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 13 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 62 >ref|ZP_07146007.1| Hok/gef family protein [Escherichia coli MS 187-1] gb|EFK25007.1| Hok/gef family protein [Escherichia coli MS 187-1] Length=85 Score = 100 bits (249), Expect = 9e-20, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 36 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 85 >ref|ZP_07222092.1| Hok/gef family protein [Escherichia coli MS 78-1] gb|EFK72299.1| Hok/gef family protein [Escherichia coli MS 78-1] Length=53 Score = 100 bits (248), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 4 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 53 >ref|ZP_07143056.1| Hok/gef family protein [Escherichia coli MS 182-1] gb|EFK00058.1| Hok/gef family protein [Escherichia coli MS 182-1] Length=52 Score = 100 bits (248), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 3 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 52 >ref|YP_025295.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. MG1655] ref|AP_001227.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. W3110] ref|YP_001726015.1| Hok/gef cell toxic protein [Escherichia coli ATCC 8739] 56 more sequence titles

ref|YP_001729481.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. DH10B] ref|YP_001729582.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. DH10B] ref|ZP_03002081.1| Hok/gef family protein [Escherichia coli 53638] ref|ZP_03069625.1| Hok/Gef family protein [Escherichia coli 101-1] ref|YP_002328056.1| small toxic membrane peptide HokC 2 [Escherichia coli O127:H6 str. E2348/69] ref|YP_002925655.1| toxic polypeptide, small [Escherichia coli BW2952] ref|YP_003037268.1| Hok/gef cell toxic protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] ref|YP_003043769.1| toxic polypeptide, small [Escherichia coli B str. REL606] ref|ZP_05434398.1| regulatory protein MokC for HokC 2 [Shigella sp. D9] ref|YP_003227723.1| small toxic membrane polypeptide HokE [Escherichia coli O26:H11 str. 11368] ref|YP_003233132.1| small toxic membrane polypeptide HokE [Escherichia coli O111:H- str. 11128] ref|ZP_06652544.1| conserved hypothetical protein [Escherichia coli B354] ref|ZP_06940246.1| regulatory protein MokC for HokC 2 [Escherichia coli OP50] ref|ZP_07190924.1| Hok/gef family protein [Escherichia coli MS 196-1] ref|ZP_07778671.1| hok/gef family protein [Escherichia coli 2362-75] ref|ZP_07784837.1| hok/gef family protein [Escherichia coli 1827-70] ref|ZP_08342211.1| conserved domain protein [Escherichia coli H736] ref|ZP_08394127.1| hok/Gef family protein [Shigella sp. D9] sp|P77091.2|HOKE_ECOLI RecName: Full=Protein hokE gb|AAT48125.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. MG1655] dbj|BAA35222.2| toxic polypeptide, small [Escherichia coli str. K12 substr. W3110] gb|ACA78688.1| Hok/gef cell toxic protein [Escherichia coli ATCC 8739] gb|ACB01703.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. DH10B] gb|ACB01804.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. DH10B] gb|EDU65113.1| Hok/gef family protein [Escherichia coli 53638] gb|EDX39687.1| Hok/Gef family protein [Escherichia coli 101-1] emb|CAS08031.1| small toxic membrane peptide HokC 2 [Escherichia coli O127:H6 str. E2348/69] gb|ACR65667.1| toxic polypeptide, small [Escherichia coli BW2952] emb|CAQ31053.1| hokE [Escherichia coli BL21(DE3)] gb|ACT30083.1| Hok/gef cell toxic protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gb|ACT38233.1| toxic polypeptide, small [Escherichia coli B str. REL606] gb|ACT42426.1| toxic polypeptide, small [Escherichia coli BL21(DE3)] dbj|BAI23983.1| small toxic membrane polypeptide HokE [Escherichia coli O26:H11 str. 11368] dbj|BAI34581.1| small toxic membrane polypeptide HokE [Escherichia coli O111:H- str. 11128] gb|EFF14366.1| conserved hypothetical protein [Escherichia coli B354] gb|EFI87486.1| Hok/gef family protein [Escherichia coli MS 196-1] emb|CBJ00116.1| putative host cell-killing modulation protein [Escherichia coli ETEC H10407] gb|EFQ02443.1| hok/gef family protein [Escherichia coli 1827-70] gb|EFR18730.1| hok/gef family protein [Escherichia coli 2362-75] dbj|BAJ42406.1| Hok/Gef family protein [Escherichia coli DH1] gb|EFU97123.1| hok/gef family protein [Escherichia coli 3431] gb|EFW51993.1| HokE protein [Shigella dysenteriae CDC 74-1112] gb|EFW57848.1| HokE protein [Shigella flexneri CDC 796-83] gb|EFZ39953.1| hok/gef family protein [Escherichia coli EPECa14] gb|EFZ49827.1| hok/gef family protein [Shigella sonnei 53G] gb|EFZ56351.1| hok/gef family protein [Escherichia coli LT-68] gb|EFZ76483.1| hok/gef family protein [Escherichia coli RN587/1] gb|EGB34692.1| hok/gef family protein [Escherichia coli E1520] gb|EGB39274.1| hok/gef family protein [Escherichia coli E482] gb|EGB54525.1| hok/gef family protein [Escherichia coli H489] gb|EGB67417.1| hok/gef family protein [Escherichia coli TA007] gb|EGB89407.1| Hok/gef family protein [Escherichia coli MS 117-3] gb|EGI10094.1| conserved domain protein [Escherichia coli H736] gb|EGJ03656.1| hok/gef family protein [Shigella boydii 3594-74] gb|EGJ07412.1| hok/Gef family protein [Shigella sp. D9] gb|AEE55256.1| conserved hypothetical protein [Escherichia coli UMNK88]

Length=50 Score = 99.8 bits (247), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 >ref|ZP_08372876.1| conserved domain protein [Escherichia coli TA280] gb|EGI42428.1| conserved domain protein [Escherichia coli TA280] Length=83 Score = 99.8 bits (247), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 34 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 83 >ref|YP_001879248.1| Hok/Gef family protein [Shigella boydii CDC 3083-94] ref|YP_002291922.1| hypothetical protein ECSE_0647 [Escherichia coli SE11] ref|YP_002386037.1| putative small toxic membrane polypeptide HokE-like protein (partial) [Escherichia coli IAI1] 19 more sequence titles Length=83 Score = 99.4 bits (246), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 34 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 83 >ref|NP_836210.1| hypothetical protein S0500 [Shigella flexneri 2a str. 2457T] gb|AAP16016.1| hypothetical protein S0500 [Shigella flexneri 2a str. 2457T] gb|ADA72869.1| hypothetical protein SFxv_0545 [Shigella flexneri 2002017] Length=83 Score = 99.4 bits (246), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 34 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 83 >ref|YP_002383633.1| small toxic membrane polypeptide, HokE-like protein (partial) [Escherichia fergusonii ATCC 35469] emb|CAQ90021.1| putative small toxic membrane polypeptide, Putative HokE-like protein (partial) [Escherichia fergusonii ATCC 35469] Length=83 Score = 99.4 bits (246), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 34 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 83 >ref|NP_286308.1| hypothetical protein Z0722 [Escherichia coli O157:H7 EDL933] ref|NP_308648.1| hypothetical protein ECs0621 [Escherichia coli O157:H7 str. Sakai] ref|ZP_03081511.1| hypothetical protein EscherichcoliO157_06641 [Escherichia coli O157:H7 str. EC4024] 14 more sequence titles Length=83 Score = 99.4 bits (246), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 34 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 83 >ref|ZP_07154320.1| Hok/gef family protein [Escherichia coli MS 21-1] gb|EFK18986.1| Hok/gef family protein [Escherichia coli MS 21-1] gb|ADR25955.1| putative small toxic membrane polypeptide, Putative HokE-like protein [Escherichia coli O83:H1 str. NRG 857C] Length=83 Score = 99.4 bits (246), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 34 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 83 >ref|YP_002291921.1| hypothetical protein ECSE_0646 [Escherichia coli SE11] ref|ZP_06661128.1| hokE [Escherichia coli B088] ref|ZP_08376947.1| conserved domain protein [Escherichia coli H591] dbj|BAG76170.1| conserved hypothetical protein [Escherichia coli SE11] gb|EFE64636.1| hokE [Escherichia coli B088] gb|EGI47575.1| conserved domain protein [Escherichia coli H591] Length=62 Score = 98.6 bits (244), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFK VLAYEPKK Sbjct 13 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKVVLAYEPKK 62 >ref|YP_668540.1| hypothetical protein ECP_0613 [Escherichia coli 536] ref|YP_002411434.1| toxic polypeptide, small [Escherichia coli UMN026] ref|ZP_06989227.1| hokE [Escherichia coli FVEC1302] 9 more sequence titles Length=62 Score = 98.6 bits (244), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 13 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 62 >ref|ZP_03031064.1| Hok/Gef family protein [Escherichia coli B7A] ref|ZP_03044425.1| Hok/Gef family protein [Escherichia coli E22] ref|ZP_03050020.1| Hok/Gef family protein [Escherichia coli E110019] 24 more sequence titles Length=50 Score = 98.2 bits (243), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFK VLAYEPKK Sbjct 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKVVLAYEPKK 50 >ref|ZP_02804074.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4076] ref|ZP_02811431.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC869] ref|YP_001742698.1| Hok/Gef family protein [Escherichia coli SMS-3-5] 139 more sequence titles

ref|ZP_02799646.2| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4196] ref|ZP_02772774.2| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4113] ref|ZP_02779684.2| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4401] ref|ZP_02795187.2| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4486] ref|ZP_02785281.2| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4501] ref|ZP_02823144.2| Hok/Gef family protein [Escherichia coli O157:H7 str. EC508] ref|ZP_03031073.1| Hok/Gef family protein [Escherichia coli B7A] ref|ZP_03033878.1| Hok/Gef family protein [Escherichia coli F11] ref|ZP_03044494.1| Hok/Gef family protein [Escherichia coli E22] ref|ZP_03050014.1| Hok/Gef family protein [Escherichia coli E110019] ref|ZP_03060553.1| Hok/Gef family protein [Escherichia coli B171] ref|ZP_03251179.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4206] ref|ZP_03257511.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4045] ref|ZP_03263185.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4042] ref|YP_002269214.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4115] ref|ZP_03442036.1| Hok/Gef family protein [Escherichia coli O157:H7 str. TW14588] ref|YP_002390435.1| toxic polypeptide, small [Escherichia coli S88] ref|YP_002396620.1| toxic polypeptide, small [Escherichia coli ED1a] ref|YP_002411435.1| toxic polypeptide, small [Escherichia coli UMN026] ref|ZP_04002244.1| Hok/Gef family protein [Escherichia coli 83972] ref|ZP_04537929.1| hok/Gef family protein [Escherichia sp. 3_2_53FAA] ref|YP_003076585.1| toxic polypeptide, small [Escherichia coli O157:H7 str. TW14359] ref|YP_003220587.1| small toxic membrane peptide HokC [Escherichia coli O103:H2 str. 12009] ref|YP_003227725.1| small toxic membrane peptide HokC [Escherichia coli O26:H11 str. 11368] ref|YP_003233134.1| small toxic membrane peptide HokC [Escherichia coli O111:H- str. 11128] ref|ZP_05950276.1| regulatory peptide MokC [Escherichia coli O157:H7 str. FRIK966] ref|ZP_06647838.1| conserved hypothetical protein [Escherichia coli FVEC1412] ref|ZP_06647839.1| conserved hypothetical protein [Escherichia coli FVEC1412] ref|ZP_06661129.1| hokE [Escherichia coli B088] ref|ZP_06989191.1| hokE [Escherichia coli FVEC1302] ref|ZP_06989226.1| hokE [Escherichia coli FVEC1302] ref|ZP_07119190.1| Hok/gef family protein [Escherichia coli MS 198-1] ref|ZP_07196711.1| Hok/gef family protein [Escherichia coli MS 185-1] ref|ZP_07447178.1| regulatory peptide MokC [Escherichia coli NC101] ref|ZP_07592334.1| Hok/gef cell toxic protein [Escherichia coli W] ref|ZP_08346842.1| conserved domain protein [Escherichia coli M605] ref|ZP_08357570.1| conserved domain protein [Escherichia coli TA206] ref|ZP_08357571.1| conserved domain protein [Escherichia coli TA206] ref|ZP_08359405.1| conserved domain protein [Escherichia coli TA206] ref|ZP_08362869.1| conserved domain protein [Escherichia coli TA143] ref|ZP_08367805.1| conserved domain protein [Escherichia coli TA271] ref|ZP_08376948.1| conserved domain protein [Escherichia coli H591] ref|ZP_08382599.1| conserved domain protein [Escherichia coli H299] ref|ZP_08382600.1| conserved domain protein [Escherichia coli H299] ref|ZP_08382601.1| conserved domain protein [Escherichia coli H299] ref|ZP_08382602.1| conserved domain protein [Escherichia coli H299] ref|ZP_08382623.1| conserved domain protein [Escherichia coli H299] ref|ZP_08382624.1| conserved domain protein [Escherichia coli H299] sp|Q8XBW9.2|HOKE_ECO57 RecName: Full=Protein hokE sp|Q7UDF9.2|HOKE_SHIFL RecName: Full=Protein hokE gb|ACB19194.1| Hok/Gef family protein [Escherichia coli SMS-3-5] gb|EDU33568.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4196] gb|EDU55694.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4113] gb|EDU72116.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4076] gb|EDU76433.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4401] gb|EDU79309.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4486] gb|EDU87604.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4501] gb|EDU92191.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC869] gb|EDU97729.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC508] gb|EDV60448.1| Hok/Gef family protein [Escherichia coli B7A] gb|EDV67032.1| Hok/Gef family protein [Escherichia coli F11] gb|EDV83592.1| Hok/Gef family protein [Escherichia coli E22] gb|EDV88045.1| Hok/Gef family protein [Escherichia coli E110019] gb|EDX30260.1| Hok/Gef family protein [Escherichia coli B171] gb|EDZ78244.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4206] gb|EDZ81668.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4045] gb|EDZ84744.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4042] gb|ACI34717.1| Hok/Gef family protein [Escherichia coli O157:H7 str. EC4115] gb|EEC30597.1| Hok/Gef family protein [Escherichia coli O157:H7 str. TW14588] emb|CAR01962.1| toxic polypeptide, small [Escherichia coli S88] emb|CAR06784.1| toxic polypeptide, small [Escherichia coli ED1a] emb|CAR11889.1| toxic polypeptide, small [Escherichia coli UMN026] emb|CAP75081.1| Protein hokE [Escherichia coli LF82] gb|EEH84917.1| hok/Gef family protein [Escherichia sp. 3_2_53FAA] gb|EEJ48991.1| Hok/Gef family protein [Escherichia coli 83972] gb|ACT70509.1| toxic polypeptide, small [Escherichia coli O157:H7 str. TW14359] dbj|BAI23985.1| small toxic membrane peptide HokC [Escherichia coli O26:H11 str. 11368] dbj|BAI29453.1| small toxic membrane peptide HokC [Escherichia coli O103:H2 str. 12009] dbj|BAI34583.1| small toxic membrane peptide HokC [Escherichia coli O111:H- str. 11128] emb|CBG33442.1| putative host cell-killing modulation protein [Escherichia coli 042] emb|CBG33444.1| putative host cell-killing modulation protein [Escherichia coli 042] gb|EFE64637.1| hokE [Escherichia coli B088] gb|EFF01455.1| conserved hypothetical protein [Escherichia coli FVEC1412] gb|EFF01456.1| conserved hypothetical protein [Escherichia coli FVEC1412] gb|ADE89631.1| Hok/Gef family protein [Escherichia coli IHE3034] gb|EFI20827.1| hokE [Escherichia coli FVEC1302] gb|EFI21510.1| hokE [Escherichia coli FVEC1302] gb|EFJ54828.1| Hok/gef family protein [Escherichia coli MS 185-1] gb|EFJ71341.1| Hok/gef family protein [Escherichia coli MS 198-1] gb|EFM54187.1| regulatory peptide MokC [Escherichia coli NC101] gb|EFN37909.1| Hok/gef cell toxic protein [Escherichia coli W] gb|ADN72283.1| regulatory peptide MokC [Escherichia coli UM146] emb|CBY17570.1| unnamed protein product [Escherichia coli LF82] gb|ADR25957.1| regulatory peptide MokC [Escherichia coli O83:H1 str. NRG 857C] gb|EFS11519.1| hok/gef family protein [Shigella flexneri 2a str. 2457T] gb|ADT74164.1| toxic polypeptide, small [Escherichia coli W] gb|EFU58415.1| Hok/gef family protein [Escherichia coli MS 16-3] gb|EFW51991.1| HokE protein [Shigella dysenteriae CDC 74-1112] gb|EFW67629.1| HokE protein [Escherichia coli O157:H7 str. EC1212] gb|EFW68864.1| HokE protein [Escherichia coli WV_060327] gb|EFW72894.1| HokE protein [Escherichia coli EC4100B] gb|EFX07795.1| regulatory peptide MokC [Escherichia coli O157:H7 str. G5101] gb|EFX12607.1| regulatory peptide MokC [Escherichia coli O157:H- str. 493-89] gb|EFZ39951.1| hok/gef family protein [Escherichia coli EPECa14] gb|EFZ65504.1| hok/gef family protein [Escherichia coli 1180] gb|EFZ70299.1| hok/gef family protein [Escherichia coli 1357] gb|EGB41215.1| hok/gef family protein [Escherichia coli H120] gb|EGB48708.1| hok/gef family protein [Escherichia coli H252] gb|EGB54047.1| hok/gef family protein [Escherichia coli H263] gb|EGB71527.1| hok/gef family protein [Escherichia coli TW10509] gb|EGB75568.1| Hok/gef family protein [Escherichia coli MS 57-2] gb|EGB79757.1| Hok/gef family protein [Escherichia coli MS 60-1] gb|EGC08681.1| hok/gef family protein [Escherichia fergusonii B253] gb|EGC08682.1| hok/gef family protein [Escherichia fergusonii B253] gb|EGC09335.1| hok/gef family protein [Escherichia coli E1167] gb|EGC09336.1| hok/gef family protein [Escherichia coli E1167] gb|EGD65126.1| HokE protein [Escherichia coli O157:H7 str. 1044] gb|EGD69627.1| HokE protein [Escherichia coli O157:H7 str. 1125] gb|EGH38852.1| HokE protein [Escherichia coli AA86] gb|EGI16618.1| conserved domain protein [Escherichia coli M605] gb|EGI26450.1| conserved domain protein [Escherichia coli TA206] gb|EGI26865.1| conserved domain protein [Escherichia coli TA206] gb|EGI26866.1| conserved domain protein [Escherichia coli TA206] gb|EGI32332.1| conserved domain protein [Escherichia coli TA143] gb|EGI38039.1| conserved domain protein [Escherichia coli TA271] gb|EGI47576.1| conserved domain protein [Escherichia coli H591] gb|EGI51852.1| conserved domain protein [Escherichia coli H299] gb|EGI51853.1| conserved domain protein [Escherichia coli H299] gb|EGI51971.1| conserved domain protein [Escherichia coli H299] gb|EGI51972.1| conserved domain protein [Escherichia coli H299] gb|EGI51973.1| conserved domain protein [Escherichia coli H299] gb|EGI51974.1| conserved domain protein [Escherichia coli H299] gb|EGJ91632.1| hok/gef family protein [Shigella flexneri 2747-71] gb|EGJ94102.1| hok/gef family protein [Shigella flexneri K-671] gb|EGJ98272.1| hokE [Shigella flexneri 2930-71] gb|EGK29434.1| hok/gef family protein [Shigella flexneri K-272] gb|EGK40091.1| hok/gef family protein [Shigella flexneri K-227] gb|EGK40789.1| hok/gef family protein [Shigella flexneri K-304] gb|AEG35335.1| Hypothetical protein ECNA114_0513 [Escherichia coli NA114]

Length=50 Score = 98.2 bits (243), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 1 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 >ref|ZP_08352607.1| conserved domain protein [Escherichia coli M718] gb|EGI21924.1| conserved domain protein [Escherichia coli M718] Length=62 Score = 97.8 bits (242), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 48/50 (96%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEF+AVLAYEPKK Sbjct 13 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFRAVLAYEPKK 62 >gb|EFX27672.1| Hok/Gef family protein [Escherichia coli O55:H7 str. USDA 5905] Length=98 Score = 97.4 bits (241), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTV GFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 49 MLTKYALVAVIVLCLTVPGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 98 >gb|EGB62945.1| hok/gef family protein [Escherichia coli M863] gb|EGB71525.1| hok/gef family protein [Escherichia coli TW10509] gb|EGB71526.1| hok/gef family protein [Escherichia coli TW10509] gb|EGC08683.1| hok/gef family protein [Escherichia fergusonii B253] gb|EGE65885.1| hok/gef family protein [Escherichia coli STEC_7v] gb|EGK29432.1| hok/gef family protein [Shigella flexneri K-272] gb|EGK40090.1| hok/gef family protein [Shigella flexneri K-227] Length=50 Score = 97.4 bits (241), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 48/50 (96%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEF+AVLAYEPKK Sbjct 1 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFRAVLAYEPKK 50 >gb|EFX22405.1| Hok/Gef family protein [Escherichia coli O55:H7 str. 3256-97 TW 07815] Length=83 Score = 97.1 bits (240), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTV GFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 34 MLTKYALVAVIVLCLTVPGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 83 >ref|ZP_08362868.1| conserved domain protein [Escherichia coli TA143] gb|EGI32331.1| conserved domain protein [Escherichia coli TA143] Length=50 Score = 97.1 bits (240), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYALAAVIVLCLTVLGFTLLVG SLCEFTVKERNIEFKAVLAYEPKK Sbjct 1 MLTKYALAAVIVLCLTVLGFTLLVGGSLCEFTVKERNIEFKAVLAYEPKK 50 >gb|EGB62943.1| hok/gef family protein [Escherichia coli M863] gb|EGE65882.1| hok/gef family protein [Escherichia coli STEC_7v] Length=50 Score = 97.1 bits (240), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 48/50 (96%), Positives = 49/50 (98%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFT+LVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 1 MLTKYALVAVIVLCLTVLGFTVLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 >ref|NP_286307.1| hypothetical protein Z0721 [Escherichia coli O157:H7 EDL933] ref|ZP_03081510.1| hypothetical protein EscherichcoliO157_06636 [Escherichia coli O157:H7 str. EC4024] ref|YP_003076584.1| hypothetical protein ECSP_0634 [Escherichia coli O157:H7 str. TW14359] 13 more sequence titles Length=98 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTV GFTLLVGDSLCEFTVKERNIEF+AVLAYEPKK Sbjct 49 MLTKYALVAVIVLCLTVPGFTLLVGDSLCEFTVKERNIEFRAVLAYEPKK 98 >ref|ZP_07680615.1| hok/gef family protein [Shigella dysenteriae 1617] gb|EFP71575.1| hok/gef family protein [Shigella dysenteriae 1617] Length=50 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVL YEPKK Sbjct 1 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLTYEPKK 50 >gb|EFZ44749.1| hok/gef family protein [Escherichia coli E128010] Length=54 Score = 95.9 bits (237), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 48/49 (97%), Positives = 48/49 (97%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFK VLAYEPKK Sbjct 6 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKVVLAYEPKK 54 >gb|EFU50703.1| Hok/gef family protein [Escherichia coli MS 153-1] Length=50 Score = 95.9 bits (237), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDS CEFTVKERNIEFKAVLAYEPKK Sbjct 1 MLTKYALVAVIVLCLTVLGFTLLVGDSRCEFTVKERNIEFKAVLAYEPKK 50 >ref|NP_836209.1| hypothetical protein S0499 [Shigella flexneri 2a str. 2457T] sp|Q7UDG0.1|HOKF_SHIFL RecName: Full=Putative protein hokF gb|AAP16015.1| hypothetical protein S0499 [Shigella flexneri 2a str. 2457T] 6 more sequence titles Length=50 Score = 95.9 bits (237), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLL GDSLCEFTVKERNIEF+AVLAYEPKK Sbjct 1 MLTKYALVAVIVLCLTVLGFTLLAGDSLCEFTVKERNIEFRAVLAYEPKK 50 >gb|EFX27568.1| Hok/Gef family protein [Escherichia coli O55:H7 str. USDA 5905] Length=50 Score = 95.5 bits (236), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTV GFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 1 MLTKYALVAVIVLCLTVPGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 >ref|ZP_07188882.1| Hok/gef family protein [Escherichia coli MS 69-1] ref|ZP_08372877.1| conserved domain protein [Escherichia coli TA280] gb|EFJ79651.1| Hok/gef family protein [Escherichia coli MS 69-1] gb|EGI42429.1| conserved domain protein [Escherichia coli TA280] Length=62 Score = 95.5 bits (236), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLV DSLCEFTVKERNIEFKAVLAYEPKK Sbjct 13 MLTKYALVAVIVLCLTVLGFTLLVRDSLCEFTVKERNIEFKAVLAYEPKK 62 >gb|EGB62944.1| hok/gef family protein [Escherichia coli M863] gb|EGE65883.1| hok/gef family protein [Escherichia coli STEC_7v] Length=50 Score = 95.5 bits (236), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKE NIEF+AVLAYEPKK Sbjct 1 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKEHNIEFRAVLAYEPKK 50 >ref|ZP_06652546.1| conserved hypothetical protein [Escherichia coli B354] gb|EFF14368.1| conserved hypothetical protein [Escherichia coli B354] Length=50 Score = 95.1 bits (235), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTVLGFTLLV DSLCEFTVKERNIEFKAVLAYEPKK Sbjct 1 MLTKYALVAVIVLCLTVLGFTLLVRDSLCEFTVKERNIEFKAVLAYEPKK 50 >ref|ZP_02902179.1| Hok/Gef family protein [Escherichia albertii TW07627] gb|EDS92145.1| Hok/Gef family protein [Escherichia albertii TW07627] Length=50 Score = 95.1 bits (235), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVI LCLTVLGFT LVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 1 MLTKYALVAVIALCLTVLGFTFLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 >ref|NP_308647.1| hypothetical protein ECs0620 [Escherichia coli O157:H7 str. Sakai] ref|ZP_03440574.1| Hok/Gef family protein [Escherichia coli O157:H7 str. TW14588] ref|ZP_05938329.1| hypothetical protein EscherichiacoliO157_05514 [Escherichia coli O157:H7 str. FRIK2000] 7 more sequence titles Length=50 Score = 94.7 bits (234), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTV GFTLLVGDSLCEFTVKERNIEF+AVLAYEPKK Sbjct 1 MLTKYALVAVIVLCLTVPGFTLLVGDSLCEFTVKERNIEFRAVLAYEPKK 50 >gb|EFX31969.1| Hok/Gef family protein [Escherichia coli O157:H7 str. LSU-61] Length=98 Score = 94.0 bits (232), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL AVIVLCLTV GFTLLVGDSLCEFTVKERNIEF+AVLAY PKK Sbjct 49 MLTKYALVAVIVLCLTVPGFTLLVGDSLCEFTVKERNIEFRAVLAYGPKK 98 >ref|YP_003364210.1| host cell-killing modulation protein [Citrobacter rodentium ICC168] emb|CBG87357.1| putative host cell-killing modulation protein [Citrobacter rodentium ICC168] Length=50 Score = 91.7 bits (226), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL A+IVLC+TVLGFTLLVGDSLCEF+VKER +EFKAVLAYEPKK Sbjct 1 MLTKYALMAIIVLCVTVLGFTLLVGDSLCEFSVKERGMEFKAVLAYEPKK 50 >ref|YP_001336726.1| small toxic membrane polypeptide [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] ref|ZP_06550437.1| hokE [Klebsiella sp. 1_1_55] gb|ABR78496.1| small toxic membrane polypeptide [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gb|EFD84060.1| hokE [Klebsiella sp. 1_1_55] Length=67 Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL A+IVLC+TVLGFTLLV SLCE ++KERNIEFKAVLAYE KK Sbjct 18 MLTKYALVAIIVLCITVLGFTLLVHSSLCELSIKERNIEFKAVLAYESKK 67 >ref|YP_002236897.1| Hok/Gef family protein [Klebsiella pneumoniae 342] ref|YP_003437910.1| Hok/gef cell toxic protein [Klebsiella variicola At-22] gb|ACI09617.1| Hok/Gef family protein [Klebsiella pneumoniae 342] gb|ADC56898.1| Hok/gef cell toxic protein [Klebsiella variicola At-22] Length=50 Score = 85.5 bits (210), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL A+IVLC+TVLGFTLLV SLCE ++KERNIEFKAVLAYE KK Sbjct 1 MLTKYALVAIIVLCITVLGFTLLVHSSLCELSIKERNIEFKAVLAYESKK 50 >ref|YP_003500907.1| Small toxic membrane polypeptide [Escherichia coli O55:H7 str. CB9615] gb|ADD57923.1| Small toxic membrane polypeptide [Escherichia coli O55:H7 str. CB9615] Length=95 Score = 84.7 bits (208), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL A+IVLC TVLGFTL+VGDSLCE +++ER +EFKAVLAYE KK Sbjct 46 MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK 95 >ref|YP_001881499.1| hok/gef family protein [Shigella boydii CDC 3083-94] ref|ZP_03028649.1| conserved domain protein [Escherichia coli B7A] ref|ZP_03071071.1| conserved domain protein [Escherichia coli 101-1] 29 more sequence titles

ref|YP_002408874.1| small toxic peptide [Escherichia coli IAI39] ref|YP_003035219.1| Hok/gef cell toxic protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] ref|ZP_05438602.1| Hok/gef cell toxic protein [Escherichia sp. 4_1_40B] ref|ZP_06654832.1| conserved hypothetical protein [Escherichia coli B354] ref|ZP_06938105.1| Hok/gef cell toxic protein [Escherichia coli OP50] ref|ZP_07151353.1| Hok/gef family protein [Escherichia coli MS 21-1] ref|ZP_07243400.1| Hok/gef family protein [Escherichia coli MS 146-1] ref|ZP_07498801.1| Hok/gef cell toxic protein [Escherichia coli H736] ref|ZP_07592440.1| Hok/gef cell toxic protein [Escherichia coli W] ref|ZP_07689653.1| Hok/gef family protein [Escherichia coli MS 145-7] ref|ZP_08344575.1| conserved domain protein [Escherichia coli H736] ref|ZP_08375019.1| conserved domain protein [Escherichia coli TA280] gb|ACD07980.1| hok/gef family protein [Shigella boydii CDC 3083-94] gb|EDV62917.1| conserved domain protein [Escherichia coli B7A] gb|EDX38111.1| conserved domain protein [Escherichia coli 101-1] emb|CAR19062.1| similar to host killing peptides encoded by hok genes [Escherichia coli IAI39] gb|ACT28034.1| Hok/gef cell toxic protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gb|EFF11371.1| conserved hypothetical protein [Escherichia coli B354] gb|EFK21925.1| Hok/gef family protein [Escherichia coli MS 21-1] gb|EFK93083.1| Hok/gef family protein [Escherichia coli MS 146-1] gb|EFN37751.1| Hok/gef cell toxic protein [Escherichia coli W] gb|EFO58467.1| Hok/gef family protein [Escherichia coli MS 145-7] gb|ADT76370.1| toxic polypeptide, small [Escherichia coli W] gb|ADX49642.1| Hok/gef cell toxic protein [Escherichia coli KO11] gb|EGB42470.1| hok/gef family protein [Escherichia coli H120] gb|EGB56287.1| hok/gef family protein [Escherichia coli H489] gb|EGB66808.1| hok/gef family protein [Escherichia coli TA007] gb|EGI09139.1| conserved domain protein [Escherichia coli H736] gb|EGI39748.1| conserved domain protein [Escherichia coli TA280]

Length=50 Score = 84.7 bits (208), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL A+IVLC TVLGFTL+VGDSLCE +++ER +EFKAVLAYE KK Sbjct 1 MLTKYALVAIIVLCFTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK 50 >ref|YP_002920949.1| small toxic membrane polypeptide [Klebsiella pneumoniae NTUH-K2044] dbj|BAH64882.1| small toxic membrane polypeptide [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] Length=67 Score = 84.0 bits (206), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL A+IVLC+TVLGFTLLV SLC+ ++KERNIEFKAVLAYE KK Sbjct 18 MLTKYALVAIIVLCITVLGFTLLVHSSLCKLSIKERNIEFKAVLAYESKK 67 >ref|ZP_07115210.1| Hok/gef family protein [Escherichia coli MS 198-1] gb|EFJ75312.1| Hok/gef family protein [Escherichia coli MS 198-1] Length=73 Score = 84.0 bits (206), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL A+IVLC TVLGFTL+VGDSLCE +++ER +EFKAVLAYE KK Sbjct 24 MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK 73 >ref|NP_289311.1| hypothetical protein Z4071 [Escherichia coli O157:H7 EDL933] ref|NP_311643.1| hypothetical protein ECs3616 [Escherichia coli O157:H7 str. Sakai] ref|YP_542108.1| hypothetical protein UTI89_C3125 [Escherichia coli UTI89] 116 more sequence titles

ref|ZP_03046144.1| conserved domain protein [Escherichia coli E22] ref|ZP_03050607.1| conserved domain protein [Escherichia coli E110019] ref|ZP_03060415.1| conserved domain protein [Escherichia coli B171] ref|ZP_03064029.1| conserved domain protein [Shigella dysenteriae 1012] ref|ZP_03084857.1| hypothetical protein EscherichcoliO157_24193 [Escherichia coli O157:H7 str. EC4024] ref|YP_002294292.1| hypothetical protein ECSE_3017 [Escherichia coli SE11] ref|YP_002388222.1| small toxic peptide [Escherichia coli IAI1] ref|YP_002392660.1| small toxic peptide [Escherichia coli S88] ref|YP_002399093.1| small toxic peptide [Escherichia coli ED1a] ref|YP_002404027.1| similar to host killing peptides encoded by hok genes [Escherichia coli 55989] ref|YP_002413776.1| small toxic peptide [Escherichia coli UMN026] ref|ZP_04006102.1| hok/gef family protein [Escherichia coli 83972] ref|ZP_04537097.1| small toxic membrane polypeptide [Escherichia sp. 3_2_53FAA] ref|YP_003079539.1| hypothetical protein ECSP_3710 [Escherichia coli O157:H7 str. TW14359] ref|ZP_05433318.1| hypothetical protein ShiD9_11102 [Shigella sp. D9] ref|YP_003223186.1| small toxic polypeptide [Escherichia coli O103:H2 str. 12009] ref|YP_003230763.1| small toxic polypeptide [Escherichia coli O26:H11 str. 11368] ref|YP_003235843.1| small toxic polypeptide [Escherichia coli O111:H- str. 11128] ref|ZP_05940338.1| hypothetical protein EscherichiacoliO157_15873 [Escherichia coli O157:H7 str. FRIK2000] ref|ZP_05949220.1| small toxic polypeptide [Escherichia coli O157:H7 str. FRIK966] ref|ZP_06650180.1| hokE protein [Escherichia coli FVEC1412] ref|ZP_06658647.1| hokG [Escherichia coli B185] ref|ZP_06663508.1| hypothetical protein ECCG_02116 [Escherichia coli B088] ref|ZP_06991587.1| hokG [Escherichia coli FVEC1302] ref|ZP_07096049.1| Hok/gef family protein [Escherichia coli MS 107-1] ref|ZP_07100700.1| Hok/gef family protein [Escherichia coli MS 119-7] ref|ZP_07124405.1| Hok/gef family protein [Escherichia coli MS 84-1] ref|ZP_07137812.1| Hok/gef family protein [Escherichia coli MS 115-1] ref|ZP_07141102.1| Hok/gef family protein [Escherichia coli MS 182-1] ref|ZP_07173343.1| Hok/gef family protein [Escherichia coli MS 200-1] ref|ZP_07173599.1| Hok/gef family protein [Escherichia coli MS 45-1] ref|ZP_07190571.1| Hok/gef family protein [Escherichia coli MS 69-1] ref|ZP_07196441.1| Hok/gef family protein [Escherichia coli MS 185-1] ref|ZP_07210636.1| Hok/gef family protein [Escherichia coli MS 124-1] ref|ZP_07219578.1| Hok/gef family protein [Escherichia coli MS 78-1] ref|ZP_07446562.1| Small toxic membrane polypeptide [Escherichia coli NC101] ref|ZP_08349566.1| conserved domain protein [Escherichia coli M605] ref|ZP_08355241.1| conserved domain protein [Escherichia coli M718] ref|ZP_08359812.1| conserved domain protein [Escherichia coli TA206] ref|ZP_08365226.1| conserved domain protein [Escherichia coli TA143] ref|ZP_08370349.1| conserved domain protein [Escherichia coli TA271] ref|ZP_08379419.1| conserved domain protein [Escherichia coli H591] ref|ZP_08384974.1| conserved domain protein [Escherichia coli H299] ref|ZP_08392987.1| small toxic membrane polypeptide [Shigella sp. D9] sp|Q8X7U9.1|HOKG_ECO57 RecName: Full=Putative protein hokG gb|AAG57869.1|AE005504_1 hypothetical protein Z4071 [Escherichia coli O157:H7 str. EDL933] dbj|BAB37039.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] gb|ABE08577.1| hypothetical protein UTI89_C3125 [Escherichia coli UTI89] gb|EDV81985.1| conserved domain protein [Escherichia coli E22] gb|EDV87469.1| conserved domain protein [Escherichia coli E110019] gb|EDX30378.1| conserved domain protein [Escherichia coli B171] gb|EDX36172.1| conserved domain protein [Shigella dysenteriae 1012] dbj|BAG78541.1| conserved hypothetical protein [Escherichia coli SE11] emb|CAU98917.1| similar to host killing peptides encoded by hok genes [Escherichia coli 55989] emb|CAQ99686.1| similar to host killing peptides encoded by hok genes [Escherichia coli IAI1] emb|CAR04269.1| similar to host killing peptides encoded by hok genes [Escherichia coli S88] emb|CAR09226.1| similar to host killing peptides encoded by hok genes [Escherichia coli ED1a] emb|CAR14256.1| similar to host killing peptides encoded by hok genes [Escherichia coli UMN026] gb|EEH85915.1| small toxic membrane polypeptide [Escherichia sp. 3_2_53FAA] gb|EEJ45032.1| hok/gef family protein [Escherichia coli 83972] gb|ACT73463.1| predicted protein [Escherichia coli O157:H7 str. TW14359] dbj|BAI27023.1| small toxic polypeptide [Escherichia coli O26:H11 str. 11368] dbj|BAI32052.1| small toxic polypeptide [Escherichia coli O103:H2 str. 12009] dbj|BAI37292.1| small toxic polypeptide [Escherichia coli O111:H- str. 11128] dbj|BAI56090.1| conserved hypothetical protein [Escherichia coli SE15] gb|ADA75110.1| putative protein hokG [Shigella flexneri 2002017] emb|CBG35786.1| putative post-segregation killing protein [Escherichia coli 042] gb|EFE61606.1| hypothetical protein ECCG_02116 [Escherichia coli B088] gb|EFE99292.1| hokE protein [Escherichia coli FVEC1412] gb|EFF05178.1| hokG [Escherichia coli B185] gb|EFI18646.1| hokG [Escherichia coli FVEC1302] gb|EFJ55099.1| Hok/gef family protein [Escherichia coli MS 185-1] gb|EFJ63111.1| Hok/gef family protein [Escherichia coli MS 200-1] gb|EFJ78668.1| Hok/gef family protein [Escherichia coli MS 69-1] gb|EFJ85061.1| Hok/gef family protein [Escherichia coli MS 84-1] gb|EFJ93506.1| Hok/gef family protein [Escherichia coli MS 45-1] gb|EFJ94941.1| Hok/gef family protein [Escherichia coli MS 115-1] gb|EFK01970.1| Hok/gef family protein [Escherichia coli MS 182-1] gb|EFK47882.1| Hok/gef family protein [Escherichia coli MS 119-7] gb|EFK52816.1| Hok/gef family protein [Escherichia coli MS 107-1] gb|EFK67890.1| Hok/gef family protein [Escherichia coli MS 124-1] gb|EFK74800.1| Hok/gef family protein [Escherichia coli MS 78-1] gb|EFM54840.1| Small toxic membrane polypeptide [Escherichia coli NC101] gb|ADN69974.1| Small toxic membrane polypeptide [Escherichia coli UM146] emb|CBY17612.1| unnamed protein product [Escherichia coli LF82] gb|ADR28113.1| small toxic polypeptide [Escherichia coli O83:H1 str. NRG 857C] gb|EFU36585.1| Hok/gef family protein [Escherichia coli MS 85-1] gb|EFU48637.1| Hok/gef family protein [Escherichia coli MS 110-3] gb|EFU53036.1| Hok/gef family protein [Escherichia coli MS 153-1] gb|EFU58006.1| Hok/gef family protein [Escherichia coli MS 16-3] gb|EFW55728.1| HokE protein [Shigella boydii ATCC 9905] gb|EFW76983.1| HokE protein [Escherichia coli EC4100B] gb|EFX09946.1| Small toxic membrane polypeptide [Escherichia coli O157:H7 str. G5101] gb|EFX14933.1| Small toxic membrane polypeptide [Escherichia coli O157:H- str. 493-89] gb|EFX19687.1| Small toxic membrane polypeptide [Escherichia coli O157:H- str. H 2687] gb|EFX24571.1| Small toxic membrane polypeptide [Escherichia coli O55:H7 str. 3256-97 TW 07815] gb|EFX29742.1| Small toxic membrane polypeptide [Escherichia coli O55:H7 str. USDA 5905] gb|EFX34355.1| Small toxic membrane polypeptide [Escherichia coli O157:H7 str. LSU-61] gb|EGB46900.1| hok/gef family protein [Escherichia coli H252] gb|EGB52956.1| hok/gef family protein [Escherichia coli H263] gb|EGB73711.1| hok/gef family protein [Escherichia coli TW10509] gb|EGB74939.1| Hok/gef family protein [Escherichia coli MS 57-2] gb|EGB84724.1| Hok/gef family protein [Escherichia coli MS 60-1] gb|EGB85500.1| Hok/gef family protein [Escherichia coli MS 117-3] gb|EGC05377.1| hok/gef family protein [Escherichia fergusonii B253] gb|EGC13896.1| hok/gef family protein [Escherichia coli E1167] gb|EGI14367.1| conserved domain protein [Escherichia coli M605] gb|EGI19700.1| conserved domain protein [Escherichia coli M718] gb|EGI25481.1| conserved domain protein [Escherichia coli TA206] gb|EGI30232.1| conserved domain protein [Escherichia coli TA143] gb|EGI35084.1| conserved domain protein [Escherichia coli TA271] gb|EGI44896.1| conserved domain protein [Escherichia coli H591] gb|EGI49203.1| conserved domain protein [Escherichia coli H299] gb|EGI92503.1| protein srnB [Shigella boydii 5216-82] gb|EGI92878.1| protein srnB [Shigella dysenteriae 155-74] gb|EGJ06272.1| small toxic membrane polypeptide [Shigella sp. D9]

Length=50 Score = 84.0 bits (206), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYAL A+IVLC TVLGFTL+VGDSLCE +++ER +EFKAVLAYE KK Sbjct 1 MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK 50 >ref|YP_003940501.1| Hok/gef cell toxic protein [Enterobacter cloacae SCF1] gb|ADO47217.1| Hok/gef cell toxic protein [Enterobacter cloacae SCF1] Length=50 Score = 80.5 bits (197), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 MLTKYA+ A+I LC+T LGFTL+V DSLCE +++ER +EFKAVLAYEPKK Sbjct 1 MLTKYAVVAIIALCITALGFTLMVRDSLCELSIRERGMEFKAVLAYEPKK 50 >gb|EFZ49828.1| hok/gef family protein [Shigella sonnei 53G] gb|EFZ65506.1| hok/gef family protein [Escherichia coli 1180] Length=39 Score = 79.0 bits (193), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%) Query 12 VLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +LCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK Sbjct 1 MLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 39 >ref|ZP_08306187.1| Hok/gef family protein [Klebsiella sp. MS 92-3] gb|EGF61697.1| Hok/gef family protein [Klebsiella sp. MS 92-3] Length=43 Score = 72.4 bits (176), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 34/42 (80%), Positives = 38/42 (90%), Gaps = 0/42 (0%) Query 9 AVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 A+IVLC+TVLGFTLLV SLCE ++KERNIEFKAVLAYE KK Sbjct 2 AIIVLCITVLGFTLLVHSSLCELSIKERNIEFKAVLAYESKK 43 >ref|ZP_07222091.1| Hok/gef family protein [Escherichia coli MS 78-1] gb|EFK72329.1| Hok/gef family protein [Escherichia coli MS 78-1] Length=69 Score = 70.9 bits (172), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 35/36 (97%), Positives = 35/36 (97%), Gaps = 0/36 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKER 36 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKER Sbjct 34 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKER 69 >ref|ZP_07143057.1| Hok/gef family protein [Escherichia coli MS 182-1] gb|EFK00021.1| Hok/gef family protein [Escherichia coli MS 182-1] Length=48 Score = 70.5 bits (171), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 35/36 (97%), Positives = 35/36 (97%), Gaps = 0/36 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKER 36 MLTKYAL AVIVLCLTVLGFTLLVGDSLCEFTVKER Sbjct 13 MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKER 48 >ref|ZP_02900778.1| conserved domain protein [Escherichia albertii TW07627] gb|EDS94044.1| conserved domain protein [Escherichia albertii TW07627] Length=39 Score = 66.2 bits (160), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 29/39 (74%), Positives = 35/39 (89%), Gaps = 0/39 (0%) Query 12 VLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +LC TVLGFTL+VGDSLCE +++ER +EFKAVLAYE KK Sbjct 1 MLCFTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK 39 >ref|YP_001144366.1| hypothetical protein ASA_P5G151 [Aeromonas salmonicida subsp. salmonicida A449] gb|ABO92618.1| conserved hypothetical protein [Aeromonas salmonicida subsp. salmonicida A449] Length=50 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M K A+ A++++C+TVL FT LV DSLCE +V++ E +A LAYEP++ Sbjct 1 MPGKTAVMALLIVCVTVLAFTALVRDSLCELSVRQGGTEIRAYLAYEPRE 50 >gb|ADA75900.1| putative membrane permeability altering protein [Shigella flexneri 2002017] gb|EGJ80419.1| protein pndA [Shigella flexneri K-671] gb|EGJ80575.1| protein pndA [Shigella flexneri 4343-70] 6 more sequence titles Length=50 Score = 49.7 bits (117), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LAY+ K+ Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLAYKLKE 50 >ref|YP_001812480.1| post-segregation killing protein [Proteus mirabilis] emb|CAQ34877.1| post-segregation killing protein [Proteus mirabilis HI4320] Length=48 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 0/48 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPK 49 +TKYAL +I +CLTVL F+LL+ D LC +V N +A L+YE + Sbjct 1 MTKYALIGLIAVCLTVLCFSLLMRDRLCSISVNSGNTVVQATLSYEER 48 >ref|ZP_08350474.1| conserved domain protein [Escherichia coli M605] dbj|BAI56932.1| conserved hypothetical protein [Escherichia coli SE15] gb|EGB61468.1| hok/gef family protein [Escherichia coli M863] gb|EGC05876.1| hok/gef family protein [Escherichia fergusonii B253] gb|EGE62901.1| protein pndA [Escherichia coli STEC_7v] gb|EGH38134.1| putative membrane permeability altering protein [Escherichia coli AA86] gb|EGI14030.1| conserved domain protein [Escherichia coli M605] gb|AEG38548.1| Toxic polypeptide, samll [Escherichia coli NA114] Length=50 Score = 47.8 bits (112), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 22/45 (48%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ N E A LA Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLA 45 >ref|YP_003367662.1| small toxic membrane protein HokA [Citrobacter rodentium ICC168] emb|CBG90945.1| small toxic membrane protein HokA [Citrobacter rodentium ICC168] Length=50 Score = 47.4 bits (111), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M K L ++IV+CLT+L FT +V DSLCE +++ N E A LA E K+ Sbjct 1 MPQKCILCSLIVICLTILLFTWMVRDSLCELHIRQGNNELAAFLACEVKQ 50 >ref|ZP_07143768.1| Hok/gef family protein [Escherichia coli MS 187-1] gb|EFK27267.1| Hok/gef family protein [Escherichia coli MS 187-1] Length=72 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 23 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLA 67 >ref|ZP_07164784.1| Hok/gef family protein [Escherichia coli MS 116-1] ref|ZP_07167458.1| Hok/gef family protein [Escherichia coli MS 175-1] gb|EFJ67804.1| Hok/gef family protein [Escherichia coli MS 175-1] gb|EFK13428.1| Hok/gef family protein [Escherichia coli MS 116-1] Length=70 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 21 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLA 65 >ref|ZP_08303544.1| Hok/gef family protein [Klebsiella sp. MS 92-3] gb|EGF64337.1| Hok/gef family protein [Klebsiella sp. MS 92-3] Length=50 Score = 45.8 bits (107), Expect = 0.003, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M KY L ++V+C T+L T +V DSLCE +++ NIE A LA + K+ Sbjct 1 MPQKYLLFGLVVICFTILLLTWMVRDSLCELQIRQGNIELVAFLACDIKQ 50 >ref|ZP_07136872.1| Hok/gef family protein [Escherichia coli MS 115-1] gb|EFJ95881.1| Hok/gef family protein [Escherichia coli MS 115-1] Length=70 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 21 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLA 65 >ref|YP_543057.1| small toxic polypeptide [Escherichia coli UTI89] ref|YP_671535.1| small toxic polypeptide [Escherichia coli 536] ref|ZP_04533809.1| small toxic polypeptide [Escherichia sp. 3_2_53FAA] 8 more sequence titles Length=70 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 21 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLA 65 >ref|YP_026229.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. MG1655] ref|AP_004237.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. W3110] ref|YP_001460350.1| small toxic polypeptide [Escherichia coli HS] 71 more sequence titles

ref|YP_001723168.1| small toxic polypeptide [Escherichia coli ATCC 8739] ref|YP_001732385.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. DH10B] ref|ZP_03032101.1| protein hokA [Escherichia coli F11] ref|ZP_03067947.1| protein hokA [Escherichia coli 101-1] ref|YP_002331273.1| small toxic polypeptide [Escherichia coli O127:H6 str. E2348/69] ref|ZP_04001529.1| small toxic polypeptide [Escherichia coli 83972] ref|YP_002928441.1| toxic polypeptide, small [Escherichia coli BW2952] ref|YP_003034440.1| small toxic polypeptide [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] ref|YP_003046588.1| small toxic polypeptide [Escherichia coli B str. REL606] ref|ZP_05439581.1| small toxic polypeptide [Escherichia sp. 4_1_40B] ref|ZP_06651104.1| small toxic polypeptide [Escherichia coli FVEC1412] ref|ZP_06939789.1| small toxic polypeptide [Escherichia coli OP50] ref|ZP_06992524.1| small toxic polypeptide [Escherichia coli FVEC1302] ref|ZP_07171452.1| Hok/gef family protein [Escherichia coli MS 45-1] ref|ZP_07173692.1| Hok/gef family protein [Escherichia coli MS 200-1] ref|ZP_07191446.1| Hok/gef family protein [Escherichia coli MS 196-1] ref|ZP_07245916.1| Hok/gef family protein [Escherichia coli MS 146-1] ref|ZP_07450227.1| small toxic polypeptide [Escherichia coli NC101] ref|ZP_07499603.1| small toxic polypeptide [Escherichia coli H736] ref|ZP_07782311.1| protein pndA [Escherichia coli 2362-75] ref|ZP_07786342.1| protein pndA [Escherichia coli 1827-70] ref|ZP_08345397.1| conserved domain protein [Escherichia coli H736] ref|ZP_08360811.1| conserved domain protein [Escherichia coli TA206] ref|ZP_08366081.1| conserved domain protein [Escherichia coli TA143] ref|ZP_08375804.1| conserved domain protein [Escherichia coli TA280] sp|P37305.1|HOKA_ECOLI RecName: Full=Protein HokA gb|AAT48191.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. MG1655] dbj|BAE77738.1| toxic polypeptide, small [Escherichia coli str. K12 substr. W3110] gb|ABV07967.1| protein hokA [Escherichia coli HS] gb|ACA75841.1| Hok/gef cell toxic protein [Escherichia coli ATCC 8739] gb|ACB04607.1| toxic polypeptide, small [Escherichia coli str. K-12 substr. DH10B] gb|EDV68942.1| protein hokA [Escherichia coli F11] gb|EDX41371.1| protein hokA [Escherichia coli 101-1] emb|CAS11357.1| small toxic membrane polypeptide HokA [Escherichia coli O127:H6 str. E2348/69] emb|CAP78017.1| Protein hokA [Escherichia coli LF82] gb|EEJ49770.1| small toxic polypeptide [Escherichia coli 83972] gb|ACR65666.1| toxic polypeptide, small [Escherichia coli BW2952] emb|CAQ33875.1| small toxic membrane polypeptide [Escherichia coli BL21(DE3)] gb|ACT27255.1| Hok/gef cell toxic protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gb|ACT41052.1| toxic polypeptide, small [Escherichia coli B str. REL606] gb|ACT45207.1| toxic polypeptide, small [Escherichia coli BL21(DE3)] gb|ACX37849.1| Hok/gef cell toxic protein [Escherichia coli DH1] gb|EFE99025.1| small toxic polypeptide [Escherichia coli FVEC1412] gb|ADE90135.1| protein hokA [Escherichia coli IHE3034] gb|EFI18283.1| small toxic polypeptide [Escherichia coli FVEC1302] gb|EFI86963.1| Hok/gef family protein [Escherichia coli MS 196-1] gb|EFJ62947.1| Hok/gef family protein [Escherichia coli MS 200-1] gb|EFJ94789.1| Hok/gef family protein [Escherichia coli MS 45-1] gb|EFK90568.1| Hok/gef family protein [Escherichia coli MS 146-1] gb|EFM50942.1| small toxic polypeptide [Escherichia coli NC101] gb|ADN72943.1| small toxic polypeptide [Escherichia coli UM146] gb|EFQ00750.1| protein pndA [Escherichia coli 1827-70] gb|EFR15268.1| protein pndA [Escherichia coli 2362-75] gb|ADR28950.1| small toxic polypeptide [Escherichia coli O83:H1 str. NRG 857C] dbj|BAJ45292.1| small toxic polypeptide [Escherichia coli DH1] gb|EFU44742.1| Hok/gef family protein [Escherichia coli MS 110-3] gb|EFU53488.1| Hok/gef family protein [Escherichia coli MS 153-1] gb|EFU59327.1| Hok/gef family protein [Escherichia coli MS 16-3] gb|EFW68563.1| putative membrane permeability altering protein [Escherichia coli WV_060327] gb|EGB31128.1| hok/gef family protein [Escherichia coli E1520] gb|EGB35752.1| hok/gef family protein [Escherichia coli E482] gb|EGB45685.1| hok/gef family protein [Escherichia coli H252] gb|EGB50678.1| hok/gef family protein [Escherichia coli H263] gb|EGB55099.1| hok/gef family protein [Escherichia coli H489] gb|EGB66603.1| hok/gef family protein [Escherichia coli TA007] gb|EGB83426.1| Hok/gef family protein [Escherichia coli MS 60-1] gb|EGI08788.1| conserved domain protein [Escherichia coli H736] gb|EGI25121.1| conserved domain protein [Escherichia coli TA206] gb|EGI29676.1| conserved domain protein [Escherichia coli TA143] gb|EGI39354.1| conserved domain protein [Escherichia coli TA280] gb|AEE58858.1| conserved hypothetical protein [Escherichia coli UMNK88]

Length=50 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLA 45 >ref|YP_312608.1| small toxic polypeptide [Shigella sonnei Ss046] gb|AAZ90373.1| Putative membrane permeability altering protein [Shigella sonnei Ss046] Length=50 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLA 45 >ref|ZP_06551228.1| small toxic polypeptide [Klebsiella sp. 1_1_55] gb|EFD83650.1| small toxic polypeptide [Klebsiella sp. 1_1_55] Length=70 Score = 45.1 bits (105), Expect = 0.004, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M KY L ++V+C T+L T +V DSLCE +++ NIE A LA + K+ Sbjct 21 MPQKYLLFGLVVICFTILLLTWMVRDSLCELQLRQGNIELVAFLACDIKQ 70 >ref|YP_003437125.1| Hok/gef cell toxic protein [Klebsiella variicola At-22] gb|ADC56113.1| Hok/gef cell toxic protein [Klebsiella variicola At-22] Length=50 Score = 45.1 bits (105), Expect = 0.005, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M KY L ++V+C T+L T +V DSLCE +++ NIE A LA + K+ Sbjct 1 MPQKYLLFGLVVICFTILLLTWMVRDSLCELQLRQGNIELVAFLACDIKQ 50 >ref|YP_001144316.1| SrnB protein [Aeromonas salmonicida subsp. salmonicida A449] gb|ABO92568.1| SrnB protein [Aeromonas salmonicida subsp. salmonicida A449] Length=120 Score = 45.1 bits (105), Expect = 0.005, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M K A+ +++++C+T LG LV DSLCE V + E + LAYE K+ Sbjct 71 MFGKTAVVSLLIVCITALGVISLVRDSLCELEVHQGETEIRLNLAYEAKR 120 >ref|YP_409869.1| small toxic polypeptide [Shigella boydii Sb227] ref|YP_001882250.1| small toxic polypeptide [Shigella boydii CDC 3083-94] gb|ABB68041.1| Putative membrane permeability altering protein [Shigella boydii Sb227] gb|ACD07595.1| protein hokA [Shigella boydii CDC 3083-94] gb|EFW52206.1| putative membrane permeability altering protein [Shigella dysenteriae CDC 74-1112] gb|EFW61786.1| putative membrane permeability altering protein [Shigella flexneri CDC 796-83] gb|EGI94519.1| protein pndA [Shigella boydii 3594-74] Length=50 Score = 45.1 bits (105), Expect = 0.005, Method: Compositional matrix adjust. Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT +V DSLCE +K+ E A LA Sbjct 1 MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLA 45 >ref|ZP_07593915.1| Hok/gef cell toxic protein [Escherichia coli W] gb|EFN36543.1| Hok/gef cell toxic protein [Escherichia coli W] gb|ADX48835.1| Hok/gef cell toxic protein [Escherichia coli KO11] Length=98 Score = 45.1 bits (105), Expect = 0.005, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 21 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLA 65 >ref|ZP_08394538.1| small toxic polypeptide [Shigella sp. D9] gb|ADT77169.1| toxic polypeptide, small [Escherichia coli W] gb|EGJ07823.1| small toxic polypeptide [Shigella sp. D9] Length=78 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLA 45 >ref|ZP_08385806.1| conserved domain protein [Escherichia coli H299] gb|EGI48803.1| conserved domain protein [Escherichia coli H299] Length=50 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 22/45 (48%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT +V DSLCE +K+ + E A LA Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMVRDSLCELHIKQGSYELAAFLA 45 >gb|EFZ68115.1| protein pndA [Escherichia coli 1357] Length=70 Score = 44.7 bits (104), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 21 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLA 65 >ref|NP_290142.1| small toxic polypeptide [Escherichia coli O157:H7 EDL933] ref|ZP_03080470.1| small toxic polypeptide [Escherichia coli O157:H7 str. EC4024] ref|ZP_05939157.1| small toxic polypeptide [Escherichia coli O157:H7 str. FRIK2000] 8 more sequence titles Length=70 Score = 44.7 bits (104), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 21 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLA 65 >ref|ZP_04872797.1| conserved hypothetical protein [Escherichia sp. 1_1_43] gb|EEH71270.1| conserved hypothetical protein [Escherichia sp. 1_1_43] Length=64 Score = 44.7 bits (104), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 15 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLA 59 >ref|ZP_07172293.1| Hok/gef family protein [Escherichia coli MS 200-1] ref|YP_004119705.1| PndA [Escherichia coli] gb|ADJ38422.1| PndA [Escherichia coli] gb|EFJ63565.1| Hok/gef family protein [Escherichia coli MS 200-1] gb|EGB79999.1| Hok/gef family protein [Escherichia coli MS 60-1] Length=50 Score = 44.7 bits (104), Expect = 0.006, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M + L +IV+C+T+L F +V DSLC F +++ N F A LAYE K+ Sbjct 1 MPQRTFLMMLIVVCVTILCFVWMVRDSLCGFRIEQGNTVFVATLAYEVKR 50 >ref|YP_001745843.1| small toxic polypeptide [Escherichia coli SMS-3-5] ref|ZP_07152016.1| Hok/gef family protein [Escherichia coli MS 21-1] gb|ACB19105.1| protein hokA [Escherichia coli SMS-3-5] gb|EFK21242.1| Hok/gef family protein [Escherichia coli MS 21-1] Length=50 Score = 44.3 bits (103), Expect = 0.007, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLA 45 >ref|YP_001465033.1| small toxic polypeptide [Escherichia coli E24377A] ref|ZP_02797488.2| protein hokA [Escherichia coli O157:H7 str. EC4196] ref|ZP_02771919.2| protein hokA [Escherichia coli O157:H7 str. EC4113] 64 more sequence titles

ref|ZP_02804715.2| protein hokA [Escherichia coli O157:H7 str. EC4076] ref|ZP_02778384.2| protein hokA [Escherichia coli O157:H7 str. EC4401] ref|ZP_02790979.2| protein hokA [Escherichia coli O157:H7 str. EC4486] ref|ZP_02784656.2| protein hokA [Escherichia coli O157:H7 str. EC4501] ref|ZP_02810436.2| protein hokA [Escherichia coli O157:H7 str. EC869] ref|ZP_02822402.2| protein hokA [Escherichia coli O157:H7 str. EC508] ref|ZP_03027178.1| protein hokA [Escherichia coli B7A] ref|ZP_03042775.1| protein hokA [Escherichia coli E22] ref|ZP_03059945.1| protein hokA [Escherichia coli B171] ref|ZP_03251429.1| protein hokA [Escherichia coli O157:H7 str. EC4206] ref|ZP_03254916.1| protein hokA [Escherichia coli O157:H7 str. EC4045] ref|ZP_03260723.1| protein hokA [Escherichia coli O157:H7 str. EC4042] ref|YP_002273043.1| protein hokA [Escherichia coli O157:H7 str. EC4115] ref|ZP_03442435.1| protein hokA [Escherichia coli O157:H7 str. TW14588] ref|YP_003080351.1| small toxic polypeptide [Escherichia coli O157:H7 str. TW14359] ref|YP_003224506.1| small toxic polypeptide [Escherichia coli O103:H2 str. 12009] ref|YP_003231938.1| small toxic polypeptide [Escherichia coli O26:H11 str. 11368] ref|YP_003236690.1| small toxic polypeptide [Escherichia coli O111:H- str. 11128] ref|ZP_06664286.1| hokA [Escherichia coli B088] ref|ZP_07095441.1| Hok/gef family protein [Escherichia coli MS 107-1] ref|ZP_07120704.1| Hok/gef family protein [Escherichia coli MS 84-1] ref|ZP_07189701.1| Hok/gef family protein [Escherichia coli MS 69-1] ref|ZP_07210719.1| Hok/gef family protein [Escherichia coli MS 124-1] ref|ZP_07690610.1| Hok/gef family protein [Escherichia coli MS 145-7] gb|ABV19459.1| protein hokA [Escherichia coli E24377A] gb|EDU35581.1| protein hokA [Escherichia coli O157:H7 str. EC4196] gb|EDU56350.1| protein hokA [Escherichia coli O157:H7 str. EC4113] gb|EDU71305.1| protein hokA [Escherichia coli O157:H7 str. EC4076] gb|EDU77339.1| protein hokA [Escherichia coli O157:H7 str. EC4401] gb|EDU82944.1| protein hokA [Escherichia coli O157:H7 str. EC4486] gb|EDU88206.1| protein hokA [Escherichia coli O157:H7 str. EC4501] gb|EDU92917.1| protein hokA [Escherichia coli O157:H7 str. EC869] gb|EDU98357.1| protein hokA [Escherichia coli O157:H7 str. EC508] gb|EDV64443.1| protein hokA [Escherichia coli B7A] gb|EDV85065.1| protein hokA [Escherichia coli E22] gb|EDX30709.1| protein hokA [Escherichia coli B171] gb|EDZ78494.1| protein hokA [Escherichia coli O157:H7 str. EC4206] gb|EDZ83551.1| protein hokA [Escherichia coli O157:H7 str. EC4045] gb|EDZ88208.1| protein hokA [Escherichia coli O157:H7 str. EC4042] gb|ACI38168.1| protein hokA [Escherichia coli O157:H7 str. EC4115] gb|EEC30996.1| protein hokA [Escherichia coli O157:H7 str. TW14588] gb|ACT74275.1| toxic polypeptide, small [Escherichia coli O157:H7 str. TW14359] dbj|BAI28198.1| small toxic polypeptide [Escherichia coli O26:H11 str. 11368] dbj|BAI33372.1| small toxic polypeptide [Escherichia coli O103:H2 str. 12009] dbj|BAI38139.1| small toxic polypeptide [Escherichia coli O111:H- str. 11128] gb|EFE61424.1| hokA [Escherichia coli B088] gb|EFJ79160.1| Hok/gef family protein [Escherichia coli MS 69-1] gb|EFJ88715.1| Hok/gef family protein [Escherichia coli MS 84-1] gb|EFK53170.1| Hok/gef family protein [Escherichia coli MS 107-1] gb|EFK67848.1| Hok/gef family protein [Escherichia coli MS 124-1] gb|EFO57522.1| Hok/gef family protein [Escherichia coli MS 145-7] emb|CBJ03302.1| putative transmembrane Hok family protein [Escherichia coli ETEC H10407] gb|EFU34055.1| Hok/gef family protein [Escherichia coli MS 85-1] gb|EFW56979.1| putative membrane permeability altering protein [Shigella boydii ATCC 9905] gb|EFW66036.1| putative membrane permeability altering protein [Escherichia coli O157:H7 str. EC1212] gb|EFW76002.1| putative membrane permeability altering protein [Escherichia coli EC4100B] gb|EFZ40120.1| protein pndA [Escherichia coli EPECa14] gb|EFZ46613.1| protein pndA [Escherichia coli E128010] gb|EFZ59844.1| protein pndA [Escherichia coli LT-68] gb|EFZ65046.1| protein pndA [Escherichia coli 1180] gb|EGB40616.1| hok/gef family protein [Escherichia coli H120] gb|EGC10480.1| hok/gef family protein [Escherichia coli E1167] gb|EGD61273.1| putative membrane permeability altering protein [Escherichia coli O157:H7 str. 1044] gb|EGD63770.1| putative membrane permeability altering protein [Escherichia coli O157:H7 str. 1125]

Length=50 Score = 44.3 bits (103), Expect = 0.007, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLA 45 >ref|ZP_04621153.1| hypothetical protein yaldo0001_36870 [Yersinia aldovae ATCC 35236] gb|EEP94319.1| hypothetical protein yaldo0001_36870 [Yersinia aldovae ATCC 35236] Length=50 Score = 44.3 bits (103), Expect = 0.007, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M K + ++++C+TVL FTL+ SLCE +K+ N E A+LAYE ++ Sbjct 1 MPQKTFVLCLLIVCITVLAFTLITHKSLCELRLKDGNKEVAAILAYESER 50 >ref|YP_002295106.1| small toxic polypeptide [Escherichia coli SE11] dbj|BAG79355.1| conserved hypothetical protein [Escherichia coli SE11] Length=70 Score = 44.3 bits (103), Expect = 0.007, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 21 MPQKYRLLSLIVICYTLLFFTWMIRDSLCELHIKQGSYELAAFLA 65 >ref|YP_001337574.1| small toxic polypeptide [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] ref|YP_002921767.1| small toxic polypeptide [Klebsiella pneumoniae NTUH-K2044] gb|ABR79307.1| putative hok/gef cell toxic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] dbj|BAH65700.1| putative hok/gef cell toxic protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] Length=70 Score = 44.3 bits (103), Expect = 0.008, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M KY L ++V+C T+L T +V DSLCE ++ NIE A LA + K+ Sbjct 21 MPQKYLLFGLVVICFTILLLTWMVRDSLCELQRRQGNIELVAFLACDIKQ 70 >ref|ZP_04627665.1| hypothetical protein yberc0001_14270 [Yersinia bercovieri ATCC 43970] gb|EEQ07513.1| hypothetical protein yberc0001_14270 [Yersinia bercovieri ATCC 43970] Length=50 Score = 44.3 bits (103), Expect = 0.008, Method: Compositional matrix adjust. Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%) Query 10 VIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 ++++C+TVL FTL+ SLCE +K+ N E A+LAYE ++ Sbjct 10 LLIVCITVLAFTLITHKSLCELRLKDGNKEVAAILAYESER 50 >ref|ZP_06658909.1| srnB protein [Escherichia coli B185] gb|EFF04609.1| srnB protein [Escherichia coli B185] Length=69 Score = 43.9 bits (102), Expect = 0.009, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C TVL F+L+ + LCE + N + LAYE +K Sbjct 21 MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK 69 >ref|ZP_03049409.1| protein hokA [Escherichia coli E110019] ref|ZP_07141499.1| Hok/gef family protein [Escherichia coli MS 182-1] ref|ZP_07221427.1| Hok/gef family protein [Escherichia coli MS 78-1] gb|EDV88539.1| protein hokA [Escherichia coli E110019] gb|EFK01584.1| Hok/gef family protein [Escherichia coli MS 182-1] gb|EFK72978.1| Hok/gef family protein [Escherichia coli MS 78-1] gb|EGB90347.1| Hok/gef family protein [Escherichia coli MS 117-3] Length=50 Score = 43.9 bits (102), Expect = 0.009, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA Sbjct 1 MPQKYRLLSLIVICYTLLFFTWMIRDSLCELHIKQGSYELAAFLA 45 >ref|ZP_07104706.1| Hok/gef family protein [Escherichia coli MS 119-7] gb|EFK43991.1| Hok/gef family protein [Escherichia coli MS 119-7] Length=68 Score = 43.9 bits (102), Expect = 0.009, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C TVL F+L+ + LCE + N + LAYE +K Sbjct 20 MTKYALIGLLAVCATVLCFSLMFRERLCELNIHRGNTVVQVTLAYEARK 68 >ref|NP_061384.1| post-segregation killing protein [Plasmid F] ref|YP_001919356.1| conserved domain protein [Escherichia coli 53638] ref|ZP_08353564.1| conserved domain protein [Escherichia coli M718] dbj|BAA97875.1| srnB' [Plasmid F] gb|ACD54554.1| conserved domain protein [Escherichia coli 53638] gb|EGI21725.1| conserved domain protein [Escherichia coli M718] Length=49 Score = 43.9 bits (102), Expect = 0.010, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C TVL F+L+ + LCE + N + LAYE +K Sbjct 1 MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK 49 >gb|EGB59887.1| hok/gef family protein [Escherichia coli M863] Length=69 Score = 43.9 bits (102), Expect = 0.010, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C TVL F+L+ + LCE + N + LAYE +K Sbjct 21 MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK 69 >gb|EFZ69370.1| protein pndA [Escherichia coli 1357] Length=43 Score = 43.9 bits (102), Expect = 0.010, Method: Compositional matrix adjust. Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%) Query 11 IVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 IV+C+T+L F +V DSLC F +++ N F A LAYE K+ Sbjct 4 IVVCVTILCFVWMVRDSLCGFRIEQGNTVFVATLAYEVKR 43 >ref|ZP_06014679.1| conserved hypothetical protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gb|EEW42213.1| conserved hypothetical protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length=43 Score = 43.9 bits (102), Expect = 0.010, Method: Compositional matrix adjust. Identities = 21/24 (87%), Positives = 23/24 (95%), Gaps = 0/24 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLV 24 MLTKYAL A+IVLC+TVLGFTLLV Sbjct 18 MLTKYALVAIIVLCITVLGFTLLV 41 >ref|YP_001965411.1| Post-segregational killing toxin [Escherichia coli] ref|ZP_03062864.1| conserved domain protein [Escherichia coli B171] ref|YP_002332180.1| post-segregational killing toxin [Escherichia coli O127:H6 str. E2348/69] gb|ABG29539.1| Post-segregational killing toxin [Escherichia coli] gb|EDX27907.1| conserved domain protein [Escherichia coli B171] emb|CAS07473.1| post-segregational killing toxin [Escherichia coli O127:H6 str. E2348/69] gb|EFZ45027.1| protein srnB [Escherichia coli E128010] Length=49 Score = 43.9 bits (102), Expect = 0.010, Method: Compositional matrix adjust. Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL V+ +C TVL F L+ + LCE + N + LAYE +K Sbjct 1 MTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK 49 >ref|NP_061383.1| modulator of post-segregation killing protein [Plasmid F] sp|P13970.1|SRNB_ECOLI RecName: Full=Protein SrnB emb|CAA32614.1| unnamed protein product [Plasmid F] gb|AAA99006.1| snrB [Escherichia coli] gb|AAA98078.1| srnB [Plasmid F] dbj|BAA97874.1| srnB [Plasmid F] prf||1207222A gene srnB Length=68 Score = 43.9 bits (102), Expect = 0.010, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C TVL F+L+ + LCE + N + LAYE +K Sbjct 20 MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK 68 >ref|ZP_06013867.1| conserved hypothetical protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gb|EEW43026.1| conserved hypothetical protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length=50 Score = 43.9 bits (102), Expect = 0.010, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M KY L ++V+C T+L T +V DSLCE ++ NIE A LA + K+ Sbjct 1 MPQKYLLFGLVVICFTILLLTWMVRDSLCELQRRQGNIELVAFLACDIKQ 50 >ref|ZP_06655660.1| small toxic polypeptide [Escherichia coli B354] gb|EFF11132.1| small toxic polypeptide [Escherichia coli B354] gb|EGB70139.1| hok/gef family protein [Escherichia coli TW10509] Length=50 Score = 43.5 bits (101), Expect = 0.012, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A LA K+ Sbjct 1 MPQKYRLLSLIVICCTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE 50 >ref|NP_053109.1| hypothetical protein pB171_047 [Escherichia coli] dbj|BAA84882.1| snrB [Escherichia coli] Length=68 Score = 43.5 bits (101), Expect = 0.012, Method: Compositional matrix adjust. Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL V+ +C TVL F L+ + LCE + N + LAYE +K Sbjct 20 MTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK 68 >ref|YP_001711926.1| hypothetical protein pVM01_p077 [Escherichia coli] gb|ACA34800.1| SrnB [Escherichia coli] gb|EGC09766.1| hok/gef family protein [Escherichia coli E1167] Length=68 Score = 43.5 bits (101), Expect = 0.012, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C TVL F+L+ + LCE + N + LAYE +K Sbjct 20 MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK 68 >ref|YP_001816555.1| SrnB [Escherichia coli 1520] ref|YP_003937652.1| modulator of post-segregation killing protein SrnB [Escherichia coli] emb|CAP07741.1| SrnB [Escherichia coli] emb|CBX35970.1| modulator of post-segregation killing protein SrnB [Escherichia coli] Length=103 Score = 43.5 bits (101), Expect = 0.012, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C TVL F+L+ + LCE + N + LAYE +K Sbjct 55 MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK 103 >ref|YP_001481218.1| hypothetical protein APECO1_O1CoBM63 [Escherichia coli APEC O1] ref|YP_002527575.1| post-segregation killing protein SrnB [Escherichia coli] ref|YP_002539334.1| Hok/Gef family protein [Escherichia coli] gb|ABD51633.1| SrnB [Escherichia coli APEC O1] gb|ACJ63604.1| post-segregation killing protein SrnB [Escherichia coli] gb|ACM18268.1| Hok/Gef family protein [Escherichia coli] gb|ADR29944.1| post-segregation killing protein SrnB [Escherichia coli O83:H1 str. NRG 857C] Length=103 Score = 43.5 bits (101), Expect = 0.013, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C TVL F+L+ + LCE + N + LAYE +K Sbjct 55 MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK 103 >ref|ZP_07125337.1| Hok/gef family protein [Escherichia coli MS 84-1] ref|ZP_07213106.1| Hok/gef family protein [Escherichia coli MS 124-1] gb|EFJ84112.1| Hok/gef family protein [Escherichia coli MS 84-1] gb|EFK65480.1| Hok/gef family protein [Escherichia coli MS 124-1] gb|EFU32557.1| Hok/gef family protein [Escherichia coli MS 85-1] gb|EFU55611.1| Hok/gef family protein [Escherichia coli MS 16-3] Length=97 Score = 43.5 bits (101), Expect = 0.014, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C TVL F+L+ + LCE + N + LAYE +K Sbjct 49 MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK 97 >ref|YP_002236068.1| protein HokA [Klebsiella pneumoniae 342] gb|ACI11712.1| protein HokA [Klebsiella pneumoniae 342] Length=50 Score = 43.1 bits (100), Expect = 0.016, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M KY L ++V+C T+L T +V DSLCE +++ +IE A LA + K+ Sbjct 1 MPQKYLLFGLVVICFTILLLTWMVRDSLCELQLRQGDIELVAFLACDIKQ 50 >ref|ZP_07248314.1| Hok/gef family protein [Escherichia coli MS 146-1] gb|EFK88153.1| Hok/gef family protein [Escherichia coli MS 146-1] Length=136 Score = 43.1 bits (100), Expect = 0.016, Method: Compositional matrix adjust. Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL V+ +C TVL F L+ + LCE + N + LAYE +K Sbjct 88 MTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK 136 >ref|ZP_08497500.1| hypothetical protein HMPREF9086_1761 [Enterobacter hormaechei ATCC 49162] gb|EGK61816.1| hypothetical protein HMPREF9086_1761 [Enterobacter hormaechei ATCC 49162] Length=93 Score = 43.1 bits (100), Expect = 0.016, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M + L + ++C T+L FT +V DSLCE ++ E AVLAYE K+ Sbjct 44 MPKRTLLLGLFLICTTLLIFTWMVRDSLCELHFRQEKTELAAVLAYEAKR 93 >ref|YP_003611380.1| small toxic polypeptide [Enterobacter cloacae subsp. cloacae ATCC 13047] gb|ADF60431.1| small toxic polypeptide [Enterobacter cloacae subsp. cloacae ATCC 13047] emb|CBK87669.1| Hok/gef family [Enterobacter cloacae subsp. cloacae NCTC 9394] Length=50 Score = 43.1 bits (100), Expect = 0.017, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M + L + ++C T+L FT +V DSLCE ++ E AVLAYE K+ Sbjct 1 MPKRTLLLGLFLICTTLLIFTWMVRDSLCELHFRQEKTELAAVLAYEAKR 50 >ref|ZP_05966793.2| hypothetical protein ENTCAN_05135 [Enterobacter cancerogenus ATCC 35316] gb|EFC57700.1| conserved domain protein [Enterobacter cancerogenus ATCC 35316] Length=93 Score = 43.1 bits (100), Expect = 0.018, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M + L + ++C T+L FT +V DSLCE ++ E AVLAYE K+ Sbjct 44 MPKRALLLGLFLICTTLLIFTWMVRDSLCELHFRQEKTELAAVLAYEAKR 93 >ref|ZP_03001470.1| protein hokA [Escherichia coli 53638] gb|EDU64502.1| protein hokA [Escherichia coli 53638] Length=50 Score = 43.1 bits (100), Expect = 0.018, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L T ++ DSLCE +K+ + E A LA Sbjct 1 MPQKYRLLSLIVICFTLLFLTWMIRDSLCELHIKQESYELAAFLA 45 >gb|EGL73446.1| protein hok [Cronobacter sakazakii E899] Length=92 Score = 42.7 bits (99), Expect = 0.019, Method: Compositional matrix adjust. Identities = 22/47 (46%), Positives = 30/47 (63%), Gaps = 0/47 (0%) Query 4 KYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 K+++ I +CLT+L FT L +SLCE +K+ EF A LAYE K Sbjct 46 KHSVLVRINVCLTLLIFTFLTRNSLCELRLKDGQREFAAFLAYESGK 92 >ref|ZP_07102183.1| Hok/gef family protein [Escherichia coli MS 119-7] ref|ZP_08371230.1| conserved domain protein [Escherichia coli TA271] ref|ZP_08380308.1| conserved domain protein [Escherichia coli H591] gb|EFK46472.1| Hok/gef family protein [Escherichia coli MS 119-7] gb|EGI34373.1| conserved domain protein [Escherichia coli TA271] gb|EGI44135.1| conserved domain protein [Escherichia coli H591] Length=50 Score = 42.7 bits (99), Expect = 0.020, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M KY L ++IV+C T+L FT ++ DSLCE +K+ E A LA K+ Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGCYELAAFLACNLKE 50 >ref|YP_003501752.1| small toxic polypeptide [Escherichia coli O55:H7 str. CB9615] gb|ADD58768.1| small toxic polypeptide [Escherichia coli O55:H7 str. CB9615] Length=70 Score = 42.7 bits (99), Expect = 0.021, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C +L FT ++ DSLCE +K+ + E A LA Sbjct 21 MPQKYRLLSLIVICFALLFFTWMIRDSLCELHIKQGSYELAAFLA 65 >ref|YP_003232548.1| modulator of post-segregation killing protein SnrB [Escherichia coli O26:H11 str. 11368] dbj|BAI28873.1| modulator of post-segregation killing protein SnrB [Escherichia coli O26:H11 str. 11368] Length=68 Score = 42.7 bits (99), Expect = 0.021, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C TVL F+L+ + LCE + N + LAYE +K Sbjct 20 MTKYALIGLLAVCATVLCFSLIFRERLCELNIYRGNTVVQVTLAYEARK 68 >ref|YP_308717.1| post-segregation killing protein [Escherichia coli] gb|AAZ76435.1| Post-segregation killing protein [Escherichia coli] Length=50 Score = 42.7 bits (99), Expect = 0.021, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M + L +IV+C+T+L F +V DSLC F V++ N A LAYE K+ Sbjct 1 MPQRTFLTMLIVVCVTILCFVWMVRDSLCGFRVEQGNTVLVATLAYEVKR 50 >ref|ZP_02901004.1| protein hokA [Escherichia albertii TW07627] gb|EDS92920.1| protein hokA [Escherichia albertii TW07627] Length=50 Score = 42.7 bits (99), Expect = 0.022, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E LA Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELATFLA 45 >gb|EGI90261.1| protein pndA [Shigella boydii 5216-82] Length=50 Score = 42.7 bits (99), Expect = 0.024, Method: Compositional matrix adjust. Identities = 20/44 (45%), Positives = 29/44 (65%), Gaps = 0/44 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVL 44 M KY L ++IV+C T+L FT ++ DSLCE +K+ + E A L Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFL 44 >ref|ZP_08368990.1| conserved domain protein [Escherichia coli TA271] gb|EGI36559.1| conserved domain protein [Escherichia coli TA271] Length=68 Score = 42.4 bits (98), Expect = 0.028, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C TVL F L+ + LCE + N + LAYE +K Sbjct 20 MTKYALIGLLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK 68 >ref|YP_405728.1| small toxic polypeptide [Shigella dysenteriae Sd197] ref|ZP_07682371.1| protein pndA [Shigella dysenteriae 1617] gb|ABB64237.1| Putative membrane permeability altering protein [Shigella dysenteriae Sd197] gb|EFP70006.1| protein pndA [Shigella dysenteriae 1617] Length=50 Score = 42.4 bits (98), Expect = 0.029, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 M KY L ++IV+C T+L FT ++ DSLCE +++ E A LA Sbjct 1 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIEQGGYELAAFLA 45 >ref|ZP_07192234.1| Hok/gef family protein [Escherichia coli MS 196-1] ref|ZP_07197903.1| Hok/gef family protein [Escherichia coli MS 185-1] gb|EFI86172.1| Hok/gef family protein [Escherichia coli MS 196-1] gb|EFJ53662.1| Hok/gef family protein [Escherichia coli MS 185-1] Length=49 Score = 42.0 bits (97), Expect = 0.032, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKY L ++ +C TVL F+L+ + LCE + N + LAYE +K Sbjct 1 MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK 49 >ref|ZP_05974139.1| conserved domain protein [Providencia rustigianii DSM 4541] ref|ZP_05974777.1| conserved domain protein [Providencia rustigianii DSM 4541] gb|EFB70306.1| conserved domain protein [Providencia rustigianii DSM 4541] gb|EFB71020.1| conserved domain protein [Providencia rustigianii DSM 4541] Length=47 Score = 42.0 bits (97), Expect = 0.032, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 0/44 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA 45 +TK+ L +I +C+TVLG +LL+ D LC F+V N +A L+ Sbjct 1 MTKFTLMGLIAVCITVLGLSLLMRDRLCSFSVISGNTAVQATLS 44 >ref|ZP_03007093.1| conserved domain protein [Escherichia coli O157:H7 str. EC4486] ref|ZP_07155354.1| Hok/gef family protein [Escherichia coli MS 21-1] ref|ZP_07193037.1| Hok/gef family protein [Escherichia coli MS 196-1] sp|P11902.1|PNDA1_ECOLX RecName: Full=Protein pndA emb|CAA31320.1| unnamed protein product [Escherichia coli] gb|EDU78974.1| conserved domain protein [Escherichia coli O157:H7 str. EC4486] gb|EFI85368.1| Hok/gef family protein [Escherichia coli MS 196-1] gb|EFK17914.1| Hok/gef family protein [Escherichia coli MS 21-1] Length=50 Score = 42.0 bits (97), Expect = 0.034, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%) Query 1 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 M + L +IV+C+T+L F +V DSLC F +++ N A LAYE K+ Sbjct 1 MPQRTFLMMLIVVCVTILCFVWMVRDSLCGFRIEQGNTVLVATLAYEVKR 50 >ref|YP_003208406.1| protein hok [Cronobacter turicensis z3032] emb|CBA26678.1| Protein hok [Cronobacter turicensis z3032] Length=52 Score = 42.0 bits (97), Expect = 0.038, Method: Compositional matrix adjust. Identities = 20/41 (48%), Positives = 27/41 (65%), Gaps = 0/41 (0%) Query 10 VIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 V+++C+T+L FT L SLCE +K+ EF A LAYE K Sbjct 12 VLMICITLLMFTFLTRHSLCELRLKDGQREFAAFLAYESGK 52 >ref|ZP_03047599.1| conserved domain protein [Escherichia coli E22] gb|EDV80459.1| conserved domain protein [Escherichia coli E22] Length=49 Score = 42.0 bits (97), Expect = 0.040, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 2 LTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 +TKYAL ++ +C VL F+L+ + LCE + N + LAYE +K Sbjct 1 MTKYALIGLLAVCAMVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK 49 >ref|YP_003212427.1| Stable plasmid inheritance protein [Cronobacter turicensis z3032] emb|CBA34388.1| Stable plasmid inheritance protein [Cronobacter turicensis z3032] Length=52 Score = 41.6 bits (96), Expect = 0.050, Method: Compositional matrix adjust. Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%) Query 10 VIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 V+++C+T+L FTLL+ SLCE K+R E A LAYE K Sbjct 12 VLIVCITLLIFTLLIRKSLCEIRYKDRYREAAAFLAYESGK 52 >ref|NP_941312.1| small toxic polypeptide [Serratia marcescens] ref|YP_002791485.1| hypothetical protein pEC-IMP_223 [Enterobacter cloacae] ref|YP_002791798.1| hypothetical protein pEC-IMPQ_230 [Enterobacter cloacae] emb|CAE51768.1| plasmid inheritance protein [Serratia marcescens] gb|ACO54109.1| hypothetical protein [Enterobacter cloacae] gb|ACO54422.1| hypothetical protein [Enterobacter cloacae] Length=52 Score = 41.2 bits (95), Expect = 0.067, Method: Compositional matrix adjust. Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%) Query 10 VIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 ++++CLT+L FT L +SLCE +K+ E A+LAYE K Sbjct 12 ILIVCLTLLIFTWLTRNSLCELRMKDGTREVSAILAYESGK 52 >emb|CBX72613.1| stable plasmid inheritance protein [Yersinia enterocolitica W22703] Length=50 Score = 40.8 bits (94), Expect = 0.070, Method: Compositional matrix adjust. Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%) Query 10 VIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 ++++C+TVL FTL+ SLCE VK E A+LAYE ++ Sbjct 10 LLIVCITVLAFTLITHKSLCELRVKNGIKEVAAILAYESER 50 >ref|ZP_06015359.1| conserved hypothetical protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gb|EEW41606.1| conserved hypothetical protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length=61 Score = 40.8 bits (94), Expect = 0.083, Method: Compositional matrix adjust. Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 0/44 (0%) Query 7 LAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 L V+++CLT+L FT L SLCE ++ N E A LAYE K Sbjct 18 LGCVLIVCLTLLIFTYLTRKSLCEIRYRDTNREVAAFLAYESAK 61 >gb|EGL71915.1| Stable plasmid inheritance protein [Cronobacter sakazakii E899] Length=52 Score = 40.4 bits (93), Expect = 0.099, Method: Compositional matrix adjust. Identities = 21/41 (51%), Positives = 27/41 (65%), Gaps = 0/41 (0%) Query 10 VIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK 50 V+++C T+L FTLL+ SLCE K+R E A LAYE K Sbjct 12 VLIVCTTLLIFTLLIRKSLCEIRYKDRYREAAAFLAYESGK 52 Lambda K H 0.328 0.141 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 153771579981 Database: nr_env Posted date: Feb 1, 2012 7:14 AM Number of letters in database: 6,167,035,527 Number of sequences in database: 20,512,688 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40