Blast performed on February-3-2012
BLASTP 2.2.24+
Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.
Reference for composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.
Database: nr_env
20,512,688 sequences; 6,167,035,527 total letters
Query= EG11347 fliF
Length=552
Score E
Sequences producing significant alignments: (Bits) Value
ref|NP_416448.1| flagellar basal-body MS-ring and collar protein... 1120 0.0
ref|YP_002412950.1| flagellar MS-ring protein [Escherichia coli ... 1119 0.0
ref|ZP_03047436.1| flagellar M-ring protein FliF [Escherichia co... 1119 0.0
ref|YP_310897.1| flagellar MS-ring protein [Shigella sonnei Ss04... 1118 0.0
ref|YP_001463240.1| flagellar MS-ring protein [Escherichia coli ... 1118 0.0
ref|YP_001724683.1| flagellar MS-ring protein [Escherichia coli ... 1118 0.0
gb|AEE56998.1| flagellar M-ring protein FliF [Escherichia coli U... 1117 0.0
gb|EFW50572.1| Flagellar M-ring protein FliF [Shigella dysenteri... 1117 0.0
ref|ZP_07592110.1| flagellar M-ring protein FliF [Escherichia co... 1117 0.0
ref|YP_002398145.1| flagellar MS-ring protein [Escherichia coli ... 1117 0.0
ref|YP_002293444.1| flagellar MS-ring protein [Escherichia coli ... 1117 0.0
ref|ZP_07690368.1| flagellar M-ring protein FliF [Escherichia co... 1116 0.0
ref|YP_003222115.1| flagellar basal-body MS-ring and collar prot... 1116 0.0
ref|ZP_05431734.1| flagellar MS-ring protein [Shigella sp. D9] >... 1116 0.0
ref|YP_407544.1| flagellar MS-ring protein [Shigella boydii Sb22... 1116 0.0
ref|ZP_03030081.1| flagellar M-ring protein FliF [Escherichia co... 1116 0.0
gb|EGB36594.1| flagellar M-ring protein FliF [Escherichia coli E... 1115 0.0
ref|ZP_07136607.1| flagellar M-ring protein FliF [Escherichia co... 1115 0.0
ref|ZP_06653870.1| flagellar M-ring protein FliF [Escherichia co... 1115 0.0
ref|ZP_03071649.1| flagellar M-ring protein FliF [Escherichia co... 1115 0.0
dbj|BAA14029.1| FliF [Escherichia coli W3110] 1115 0.0
gb|EFW57630.1| Flagellar M-ring protein FliF [Shigella boydii AT... 1114 0.0
ref|ZP_08374220.1| flagellar M-ring protein FliF [Escherichia co... 1114 0.0
gb|EGB44345.1| flagellar M-ring protein FliF [Escherichia coli H... 1114 0.0
gb|EGB75082.1| flagellar M-ring protein FliF [Escherichia coli M... 1113 0.0
gb|EGB57581.1| flagellar M-ring protein FliF [Escherichia coli H... 1113 0.0
ref|ZP_07788017.1| flagellar M-ring protein FliF [Escherichia co... 1113 0.0
ref|NP_288399.1| flagellar MS-ring protein [Escherichia coli O15... 1113 0.0
ref|ZP_08354355.1| flagellar M-ring protein FliF [Escherichia co... 1112 0.0
ref|ZP_07098850.1| flagellar M-ring protein FliF [Escherichia co... 1112 0.0
ref|ZP_05436269.1| flagellar MS-ring protein [Escherichia sp. 4_... 1112 0.0
ref|NP_754246.1| flagellar MS-ring protein [Escherichia coli CFT... 1112 0.0
gb|EGB72967.1| flagellar M-ring protein FliF [Escherichia coli T... 1111 0.0
ref|ZP_08384091.1| flagellar M-ring protein FliF [Escherichia co... 1111 0.0
ref|ZP_08358946.1| flagellar M-ring protein FliF [Escherichia co... 1111 0.0
ref|ZP_07497961.1| flagellar MS-ring protein [Escherichia coli H... 1110 0.0
gb|EGB63761.1| flagellar M-ring protein FliF [Escherichia coli M... 1110 0.0
ref|YP_541142.1| flagellar MS-ring protein [Escherichia coli UTI... 1110 0.0
gb|ADR27358.1| flagellar MS-ring protein [Escherichia coli O83:H... 1109 0.0
ref|ZP_07139914.1| flagellar M-ring protein FliF [Escherichia co... 1109 0.0
dbj|BAI55330.1| flagellar hook-basal body MS ring protein FliF [... 1109 0.0
ref|YP_002403210.1| flagellar MS-ring protein [Escherichia coli ... 1109 0.0
ref|YP_669774.1| flagellar MS-ring protein [Escherichia coli 536... 1109 0.0
gb|EFU55769.1| flagellar M-ring protein FliF [Escherichia coli M... 1108 0.0
ref|YP_003234933.1| flagellar basal-body MS-ring and collar prot... 1108 0.0
ref|YP_002407131.1| flagellar MS-ring protein [Escherichia coli ... 1108 0.0
gb|EGB82712.1| flagellar M-ring protein FliF [Escherichia coli M... 1108 0.0
gb|EFW68980.1| Flagellar M-ring protein FliF [Escherichia coli W... 1106 0.0
ref|ZP_08348624.1| flagellar M-ring protein FliF [Escherichia co... 1106 0.0
emb|CAP76418.1| flagellar M-ring protein [Escherichia coli LF82] 1106 0.0
gb|AEG36844.1| Flagellar hook basal body MS-ring protein [Escher... 1105 0.0
gb|EFZ72134.1| flagellar M-ring protein FliF [Escherichia coli R... 1104 0.0
ref|ZP_07122654.1| flagellar M-ring protein FliF [Escherichia co... 1100 0.0
ref|ZP_07117471.1| flagellar M-ring protein FliF [Escherichia co... 1031 0.0
ref|ZP_07146498.1| flagellar M-ring protein FliF [Escherichia co... 1031 0.0
gb|EGC08192.1| flagellar M-ring protein FliF [Escherichia fergus... 1030 0.0
ref|YP_002383054.1| flagellar MS-ring protein [Escherichia fergu... 1028 0.0
gb|EGB88065.1| flagellar M-ring protein FliF [Escherichia coli M... 1028 0.0
gb|EFU46099.1| flagellar M-ring protein FliF [Escherichia coli M... 1021 0.0
ref|ZP_07180829.1| flagellar M-ring protein FliF [Escherichia co... 1018 0.0
ref|ZP_02903895.1| flagellar M-ring protein FliF [Escherichia al... 1006 0.0
ref|YP_001452587.1| flagellar MS-ring protein [Citrobacter koser... 984 0.0
gb|EFY13870.1| flagellar MS-ring protein [Salmonella enterica su... 982 0.0
ref|NP_456530.1| flagellar MS-ring protein [Salmonella enterica ... 981 0.0
ref|YP_001570021.1| flagellar MS-ring protein [Salmonella enteri... 980 0.0
ref|ZP_03164293.1| flagellar M-ring protein FliF [Salmonella ent... 964 0.0
ref|YP_002215117.1| flagellar MS-ring protein [Salmonella enteri... 962 0.0
ref|ZP_04562467.1| flagellar MS-ring protein [Citrobacter sp. 30... 962 0.0
ref|ZP_03075847.1| flagellar M-ring protein FliF [Salmonella ent... 962 0.0
ref|YP_002046020.1| flagellar MS-ring protein [Salmonella enteri... 961 0.0
ref|ZP_04656295.1| flagellar MS-ring protein [Salmonella enteric... 960 0.0
ref|NP_460922.1| flagellar MS-ring protein [Salmonella enterica ... 959 0.0
ref|YP_002146054.1| flagellar MS-ring protein [Salmonella enteri... 959 0.0
ref|YP_002041234.1| flagellar MS-ring protein [Salmonella enteri... 959 0.0
ref|ZP_02681717.2| flagellar M-ring protein FliF [Salmonella ent... 959 0.0
ref|YP_002637330.1| flagellar MS-ring protein [Salmonella enteri... 958 0.0
ref|YP_002243169.1| flagellar MS-ring protein [Salmonella enteri... 957 0.0
ref|ZP_02835012.2| flagellar M-ring protein FliF [Salmonella ent... 957 0.0
ref|NP_804737.1| flagellar MS-ring protein [Salmonella enterica ... 956 0.0
emb|CBY95193.1| Flagellar M-ring protein [Salmonella enterica su... 955 0.0
ref|YP_150193.1| flagellar MS-ring protein [Salmonella enterica ... 955 0.0
ref|YP_216961.1| flagellar MS-ring protein [Salmonella enterica ... 954 0.0
ref|ZP_02346550.2| flagellar M-ring protein FliF [Salmonella ent... 950 0.0
ref|YP_002226138.1| flagellar MS-ring protein [Salmonella enteri... 949 0.0
ref|ZP_06352408.2| flagellar M-ring protein FliF [Citrobacter yo... 945 0.0
gb|EFY51826.1| flagellar MS-ring protein [Salmonella enterica su... 943 0.0
ref|YP_003613704.1| flagellar MS-ring protein [Enterobacter cloa... 940 0.0
ref|ZP_03353031.1| flagellar MS-ring protein [Salmonella enteric... 937 0.0
ref|ZP_08498679.1| flagellar M-ring protein [Enterobacter hormae... 937 0.0
ref|YP_003941351.1| flagellar M-ring protein FliF [Enterobacter ... 933 0.0
gb|EFX49677.1| Flagellar M-ring protein FliF [Salmonella enteric... 928 0.0
gb|EGE29210.1| flagellar M-ring protein FliF [Salmonella enteric... 926 0.0
gb|EGJ00512.1| flagellar M-ring protein FliF [Shigella dysenteri... 926 0.0
ref|YP_001587427.1| flagellar MS-ring protein [Salmonella enteri... 926 0.0
ref|YP_003365573.1| flagellar M-ring protein [Citrobacter rodent... 924 0.0
ref|ZP_03346035.1| flagellar MS-ring protein [Salmonella enteric... 924 0.0
ref|YP_001177249.1| flagellar MS-ring protein [Enterobacter sp. ... 923 0.0
emb|CBK87382.1| flagellar basal-body M-ring protein/flagellar ho... 911 0.0
ref|ZP_05968261.2| flagellar M-ring protein FliF [Enterobacter c... 888 0.0
ref|YP_001437358.1| flagellar MS-ring protein [Cronobacter sakaz... 868 0.0
ref|YP_003211018.1| flagellar MS-ring protein [Cronobacter turic... 864 0.0
gb|EGL74469.1| flagellar MS-ring protein [Cronobacter sakazakii ... 835 0.0
gb|EFZ60303.1| flagellar M-ring protein FliF [Escherichia coli L... 762 0.0
ref|YP_003742034.1| flagellar basal-body M-ring protein [Erwinia... 759 0.0
ref|YP_004116247.1| flagellar M-ring protein FliF [Pantoea sp. A... 759 0.0
dbj|BAK11686.1| flagellar M-ring protein FliF [Pantoea ananatis ... 731 0.0
ref|YP_001907917.1| flagellar MS-ring protein [Erwinia tasmanien... 731 0.0
ref|ZP_07380725.1| flagellar M-ring protein FliF [Pantoea sp. aB... 729 0.0
ref|YP_003520590.1| FliF [Pantoea ananatis LMG 20103] >gb|ADD774... 726 0.0
ref|YP_004213223.1| flagellar M-ring protein FliF [Rahnella sp. ... 720 0.0
ref|YP_003530869.1| flagellar M-ring protein FliF [Erwinia amylo... 715 0.0
ref|ZP_03357756.1| flagellar MS-ring protein [Salmonella enteric... 714 0.0
ref|ZP_06536456.1| flagellar MS-ring protein [Salmonella enteric... 712 0.0
ref|YP_002649114.1| flagellar MS-ring protein [Erwinia pyrifolia... 709 0.0
ref|YP_003931421.1| flagellar M-ring protein [Pantoea vagans C9-... 709 0.0
gb|ADP12294.1| flagellar MS-ring protein [Erwinia sp. Ejp617] 704 0.0
ref|ZP_08255930.1| flagellar MS-ring protein [Plautia stali symb... 703 0.0
ref|ZP_04616651.1| Flagellar M-ring protein [Yersinia ruckeri AT... 698 0.0
ref|YP_003883605.1| flagellar M-ring protein fliF [Dickeya dadan... 686 0.0
ref|YP_002987162.1| flagellar MS-ring protein [Dickeya dadantii ... 686 0.0
ref|ZP_04642049.1| Flagellar M-ring protein [Yersinia mollaretii... 684 0.0
ref|ZP_04632126.1| Flagellar M-ring protein [Yersinia frederikse... 682 0.0
ref|YP_070230.1| flagellar MS-ring protein [Yersinia pseudotuber... 681 0.0
ref|NP_669782.1| flagellar MS-ring protein [Yersinia pestis KIM ... 681 0.0
ref|ZP_04637633.1| Flagellar M-ring protein [Yersinia intermedia... 680 0.0
ref|YP_001006741.1| flagellar MS-ring protein [Yersinia enteroco... 680 0.0
ref|ZP_04613268.1| Flagellar M-ring protein [Yersinia rohdei ATC... 679 0.0
ref|YP_001721121.1| flagellar MS-ring protein [Yersinia pseudotu... 679 0.0
ref|YP_001872256.1| flagellar MS-ring protein [Yersinia pseudotu... 679 0.0
ref|ZP_04628730.1| Flagellar M-ring protein [Yersinia bercovieri... 679 0.0
ref|YP_004297919.1| flagellar MS-ring protein [Yersinia enteroco... 678 0.0
emb|CBY26761.1| flagellar M-ring protein FliF [Yersinia enteroco... 677 0.0
ref|ZP_07950837.1| flagellar M-ring protein FliF [Enterobacteria... 672 0.0
ref|ZP_04619272.1| Flagellar M-ring protein [Yersinia aldovae AT... 672 0.0
ref|YP_003333111.1| flagellar M-ring protein FliF [Dickeya dadan... 671 0.0
ref|YP_001479176.1| flagellar MS-ring protein [Serratia proteama... 670 0.0
ref|YP_004501457.1| flagellar M-ring protein FliF [Serratia sp. ... 670 0.0
ref|ZP_06190651.1| flagellar M-ring protein FliF [Serratia odori... 669 0.0
ref|YP_003003909.1| flagellar MS-ring protein [Dickeya zeae Ech1... 669 0.0
ref|ZP_04625838.1| Flagellar M-ring protein [Yersinia kristensen... 667 0.0
ref|YP_852991.1| flagellar M-ring protein [Escherichia coli APEC... 662 0.0
ref|YP_003296188.1| flagellar biosynthesis/type III secretory pa... 658 0.0
ref|YP_002933826.1| flagellar MS-ring protein [Edwardsiella icta... 654 0.0
ref|ZP_03343214.1| flagellar MS-ring protein [Salmonella enteric... 650 0.0
ref|ZP_06639886.1| flagellar M-ring protein [Serratia odorifera ... 648 0.0
ref|YP_003259279.1| flagellar MS-ring protein [Pectobacterium wa... 647 0.0
ref|YP_003018142.1| flagellar M-ring protein FliF [Pectobacteriu... 646 0.0
ref|NP_929215.1| flagellar MS-ring protein [Photorhabdus lumines... 643 0.0
ref|ZP_03826197.1| flagellar MS-ring protein [Pectobacterium car... 642 0.0
ref|YP_049826.1| flagellar MS-ring protein [Pectobacterium atros... 640 0.0
ref|ZP_03833962.1| flagellar MS-ring protein [Pectobacterium car... 639 0.0
ref|YP_002151361.1| flagellar MS-ring protein [Proteus mirabilis... 634 1e-179
ref|ZP_03840372.1| flagellar M-ring protein [Proteus mirabilis A... 633 2e-179
ref|YP_003041450.1| flagellar MS-ring protein [Photorhabdus asym... 632 4e-179
gb|EGA09449.1| flagellar MS-ring protein [Salmonella enterica su... 630 2e-178
ref|YP_004593347.1| flagellar MS-ring protein [Enterobacter aero... 619 6e-175
ref|YP_003711930.1| flagellar basal-body MS-ring and collar prot... 611 1e-172
ref|ZP_04640436.1| Flagellar M-ring protein [Yersinia mollaretii... 603 2e-170
ref|YP_003468592.1| flagellar basal-body MS(membrane and suprame... 597 2e-168
ref|ZP_03375722.1| flagellar MS-ring protein [Salmonella enteric... 580 2e-163
ref|ZP_04626851.1| Flagellar M-ring protein [Yersinia bercovieri... 573 3e-161
ref|ZP_03317640.1| hypothetical protein PROVALCAL_00554 [Provide... 571 1e-160
ref|ZP_06124181.1| flagellar M-ring protein FliF [Providencia re... 568 1e-159
ref|ZP_05971764.1| flagellar M-ring protein FliF [Providencia ru... 558 1e-156
ref|ZP_04511446.1| Flagellar M-ring protein fliF [Yersinia pesti... 557 2e-156
emb|CBA72437.1| flagellar M-ring protein FliF [Arsenophonus naso... 556 3e-156
ref|YP_003532049.1| flagellar M-ring protein FliF [Erwinia amylo... 552 7e-155
ref|YP_002647962.1| flagellar basal-body M-ring protein [Erwinia... 546 5e-153
gb|ECH37350.1| hypothetical protein GOS_5509244 [marine metagenome] 545 6e-153
gb|ADP09838.1| Flagellar basal-body M-ring protein [Erwinia sp. ... 545 1e-152
ref|ZP_02960147.1| hypothetical protein PROSTU_02060 [Providenci... 542 7e-152
gb|EBT79075.1| hypothetical protein GOS_7215404 [marine metagenome] 533 4e-149
emb|CBK86316.1| flagellar basal-body M-ring protein/flagellar ho... 533 4e-149
gb|EGK23575.1| flagellar M-ring protein domain protein [Shigella... 527 2e-147
gb|EGJ86445.1| flagellar M-ring protein domain protein [Shigella... 525 8e-147
gb|EGK22587.1| flagellar M-ring protein domain protein [Shigella... 525 9e-147
ref|ZP_06715198.1| flagellar M-ring protein FliF [Edwardsiella t... 522 6e-146
gb|EFS14571.1| flagellar M-ring domain protein [Shigella flexner... 516 4e-144
ref|YP_453733.1| flagellar basal-body M-ring protein FliF [Sodal... 513 3e-143
ref|YP_370651.1| flagellar MS-ring protein [Burkholderia sp. 383... 503 4e-140
gb|ECV29049.1| hypothetical protein GOS_2927516 [marine metagenome] 497 2e-138
ref|YP_299289.1| flagellar MS-ring protein [Ralstonia eutropha J... 496 4e-138
ref|YP_587389.1| flagellar MS-ring protein [Cupriavidus metallid... 495 1e-137
ref|ZP_02887869.1| flagellar M-ring protein FliF [Burkholderia g... 492 9e-137
ref|YP_004229845.1| flagellar M-ring protein FliF [Burkholderia ... 490 3e-136
ref|ZP_02891802.1| flagellar M-ring protein FliF [Burkholderia a... 490 3e-136
ref|YP_002229686.1| flagellar MS-ring protein [Burkholderia ceno... 488 1e-135
ref|ZP_04940246.1| Flagellar biosynthesis/type III secretory pat... 487 2e-135
ref|YP_774999.1| flagellar MS-ring protein [Burkholderia ambifar... 486 5e-135
ref|YP_001809667.1| flagellar MS-ring protein [Burkholderia ambi... 486 6e-135
ref|YP_002008773.1| flagellar ms-ring protein [Cupriavidus taiwa... 486 7e-135
ref|YP_003908566.1| flagellar M-ring protein FliF [Burkholderia ... 485 8e-135
ref|ZP_04944475.1| Flagellar biosynthesis/type III secretory pat... 485 1e-134
ref|ZP_02910625.1| flagellar M-ring protein FliF [Burkholderia a... 484 1e-134
ref|YP_622322.1| flagellar MS-ring protein [Burkholderia cenocep... 484 2e-134
ref|YP_001897382.1| flagellar MS-ring protein [Burkholderia phyt... 481 1e-133
ref|YP_560817.1| flagellar MS-ring protein [Burkholderia xenovor... 481 2e-133
ref|YP_001120975.1| flagellar MS-ring protein [Burkholderia viet... 479 4e-133
ref|YP_001859148.1| flagellar MS-ring protein [Burkholderia phym... 476 3e-132
ref|ZP_03588738.1| flagellar M-ring protein FliF [Burkholderia m... 476 4e-132
ref|ZP_06840267.1| flagellar M-ring protein FliF [Burkholderia s... 476 7e-132
ref|YP_001581242.1| flagellar MS-ring protein [Burkholderia mult... 475 8e-132
gb|EGM61553.1| hypothetical protein SFJ1713_2268 [Shigella flexn... 475 1e-131
ref|YP_001353131.1| flagellar MS-ring protein [Janthinobacterium... 474 2e-131
ref|ZP_03574976.1| flagellar M-ring protein FliF [Burkholderia m... 473 4e-131
ref|ZP_08553058.1| flagellar MS-ring protein [Salinisphaera shab... 470 3e-130
ref|ZP_03270859.1| flagellar M-ring protein FliF [Burkholderia s... 469 4e-130
ref|YP_841880.1| flagellar MS-ring protein [Ralstonia eutropha H... 469 5e-130
ref|YP_440758.3| flagellar MS-ring protein [Burkholderia thailan... 468 1e-129
ref|ZP_02386167.1| flagellar MS-ring protein [Burkholderia thail... 468 1e-129
gb|ABA50977.1| flagellar M-ring protein FliF [Burkholderia pseud... 464 1e-128
emb|CAD22875.1| basal-body M-ring protein [Erwinia chrysanthemi] 464 2e-128
ref|YP_002894863.1| flagellar M-ring protein FliF [Burkholderia ... 464 2e-128
ref|YP_001057275.1| flagellar MS-ring protein [Burkholderia pseu... 464 2e-128
ref|YP_106858.1| flagellar MS-ring protein [Burkholderia pseudom... 464 2e-128
ref|ZP_02469360.1| flagellar MS-ring protein [Burkholderia pseud... 464 2e-128
ref|ZP_02496156.1| flagellar MS-ring protein [Burkholderia pseud... 464 3e-128
ref|ZP_02445422.1| flagellar MS-ring protein [Burkholderia pseud... 463 4e-128
ref|ZP_02361239.1| flagellar MS-ring protein [Burkholderia oklah... 462 7e-128
ref|ZP_02372314.1| flagellar MS-ring protein [Burkholderia thail... 462 8e-128
ref|YP_002913118.1| flagellar MS-ring protein [Burkholderia glum... 460 2e-127
ref|ZP_02380919.1| flagellar MS-ring protein [Burkholderia ubone... 460 3e-127
ref|ZP_02488054.1| flagellar MS-ring protein [Burkholderia pseud... 460 3e-127
ref|ZP_02504197.1| flagellar MS-ring protein [Burkholderia pseud... 459 4e-127
ref|ZP_02453729.1| flagellar MS-ring protein [Burkholderia pseud... 459 4e-127
ref|ZP_02479755.1| flagellar MS-ring protein [Burkholderia pseud... 459 5e-127
ref|ZP_02354064.1| flagellar MS-ring protein [Burkholderia oklah... 459 5e-127
ref|ZP_02400838.1| flagellar MS-ring protein [Burkholderia pseud... 459 6e-127
ref|ZP_00440272.1| flagellar M-ring protein FliF [Burkholderia m... 459 9e-127
ref|YP_002946047.1| flagellar MS-ring protein [Variovorax parado... 458 1e-126
ref|YP_001100151.1| flagellar MS-ring protein [Herminiimonas ars... 457 2e-126
emb|CAL62027.2| Flagellar M-ring protein [Herminiimonas arsenico... 457 2e-126
ref|ZP_02461940.1| flagellar MS-ring protein [Burkholderia thail... 456 7e-126
gb|AAL65160.1|AF453480_2 flagellar MS ring protein [Burkholderia... 455 9e-126
gb|AAU48881.1| flagellar M-ring protein FliF [Burkholderia malle... 454 1e-125
ref|ZP_02409419.1| flagellar MS-ring protein [Burkholderia pseud... 452 6e-125
ref|YP_283999.1| flagellar MS-ring protein [Dechloromonas aromat... 449 5e-124
ref|YP_004293593.1| flagellar M-ring protein FliF [Nitrosomonas ... 447 2e-123
ref|YP_004362327.1| Flagellar M-ring protein FliF [Burkholderia ... 447 2e-123
ref|YP_003606549.1| flagellar M-ring protein FliF [Burkholderia ... 445 9e-123
gb|EGK22588.1| flagellar M-ring protein domain protein [Shigella... 444 2e-122
ref|ZP_03699734.1| flagellar M-ring protein FliF [Lutiella nitro... 444 2e-122
ref|ZP_06687421.1| flagellar M-ring protein FliF [Achromobacter ... 444 2e-122
ref|YP_003846863.1| flagellar M-ring protein FliF [Gallionella c... 444 3e-122
ref|YP_004039201.1| flagellar m-ring protein flif [Methylovorus ... 444 3e-122
ref|YP_003050531.1| flagellar M-ring protein FliF [Methylovorus ... 443 3e-122
ref|YP_786234.1| flagellar MS-ring protein [Bordetella avium 197... 443 4e-122
gb|EGK23576.1| flagellar M-ring protein domain protein [Shigella... 442 5e-122
ref|YP_003048363.1| flagellar M-ring protein FliF [Methylotenera... 440 4e-121
ref|NP_880146.1| flagellar MS-ring protein [Bordetella pertussis... 439 5e-121
ref|NP_889125.1| flagellar MS-ring protein [Bordetella bronchise... 439 7e-121
ref|ZP_07674247.1| flagellar M-ring protein FliF [Ralstonia sp. ... 439 8e-121
ref|YP_574006.1| flagellar M-ring protein FliF [Chromohalobacter... 438 1e-120
ref|ZP_08272776.1| Flagellar M-ring protein fliF [Oxalobacterace... 438 1e-120
ref|YP_412040.1| flagellar MS-ring protein [Nitrosospira multifo... 437 3e-120
ref|NP_902806.1| flagellar M-ring protein [Chromobacterium viola... 436 4e-120
ref|YP_003775467.1| hypothetical protein Hsero_2059 [Herbaspiril... 435 1e-119
ref|YP_001630756.1| flagellar MS-ring protein [Bordetella petrii... 434 1e-119
ref|YP_003978813.1| flagellar M-ring protein FliF [Achromobacter... 434 3e-119
ref|NP_871063.1| hypothetical protein WGLp060 [Wigglesworthia gl... 431 2e-118
ref|YP_746980.1| flagellar M-ring protein FliF [Nitrosomonas eut... 428 1e-117
ref|YP_003673963.1| flagellar M-ring protein FliF [Methylotenera... 427 3e-117
ref|YP_003899428.1| flagellar MS-ring protein [Halomonas elongat... 425 9e-117
ref|YP_003747621.1| FliF: flagellar biosynthesis protein, M-ring... 425 1e-116
ref|YP_001893242.1| flagellar M-ring protein FliF [Ralstonia pic... 425 1e-116
ref|YP_315358.1| flagellar MS-ring protein [Thiobacillus denitri... 424 2e-116
ref|ZP_08503331.1| Flagellar M-ring protein [Methyloversatilis u... 423 3e-116
gb|EFV86471.1| flagellar M-ring protein FliF [Achromobacter xylo... 423 4e-116
ref|YP_004415953.1| flagellar MS-ring protein [Pusillimonas sp. ... 423 5e-116
gb|ADP67048.1| flagellar MS-ring protein [Buchnera aphidicola st... 423 5e-116
gb|ADP67623.1| flagellar MS-ring protein [Buchnera aphidicola st... 422 6e-116
ref|YP_003168979.1| flagellar MS-ring protein [Candidatus Accumu... 422 8e-116
ref|YP_002467837.1| flagellar M-ring protein [Buchnera aphidicol... 422 9e-116
ref|ZP_01916408.1| flagellar M-ring protein FliF [Limnobacter sp... 422 1e-115
ref|YP_003523225.1| flagellar M-ring protein FliF [Sideroxydans ... 421 1e-115
ref|NP_239907.1| flagellar MS-ring protein [Buchnera aphidicola ... 421 2e-115
ref|NP_842093.1| fliF; flagellar M-ring transmembrane protein [N... 420 4e-115
gb|AEG72079.1| flagellar m-ring protein [Ralstonia solanacearum ... 419 7e-115
ref|ZP_03386013.1| flagellar MS-ring protein [Salmonella enteric... 419 7e-115
emb|CBJ40017.1| FliF: Flagellar biosynthesis protein, M-ring pro... 419 1e-114
ref|YP_002256768.1| flagellar m-ring protein [Ralstonia solanace... 417 2e-114
ref|YP_002796352.1| FliF1 [Laribacter hongkongensis HLHK9] >gb|A... 417 2e-114
ref|ZP_00944664.1| FliF [Ralstonia solanacearum UW551] >ref|YP_0... 416 7e-114
ref|YP_934219.1| flagellar MS-ring protein [Azoarcus sp. BH72] >... 416 8e-114
ref|YP_546086.1| flagellar M-ring protein FliF [Methylobacillus ... 414 2e-113
ref|NP_521951.1| flagellar M-ring transmembrane protein [Ralston... 414 2e-113
ref|YP_003749337.1| flif: flagellar biosynthesis protein, m-ring... 412 7e-113
ref|ZP_08620812.1| flagellar basal-body M-ring protein/flagellar... 410 4e-112
ref|YP_002799585.1| flagellar M-ring protein [Azotobacter vinela... 407 3e-111
ref|ZP_04761705.1| flagellar M-ring protein FliF [Acidovorax del... 399 5e-109
gb|ADP65897.1| flagellar MS-ring protein [Buchnera aphidicola st... 399 6e-109
ref|ZP_08407037.1| flagellar M-ring protein FliF [Hylemonella gr... 397 2e-108
ref|ZP_08018438.1| flagellar basal-body M-ring protein FliF [Lau... 397 3e-108
ref|NP_660426.1| flagellar MS-ring protein [Buchnera aphidicola ... 395 1e-107
ref|YP_972709.1| flagellar M-ring protein FliF [Acidovorax citru... 391 2e-106
ref|YP_987990.1| flagellar M-ring protein FliF [Acidovorax sp. J... 391 2e-106
ref|YP_002554514.1| flagellar m-ring protein flif [Acidovorax eb... 391 2e-106
ref|YP_004236743.1| flagellar M-ring protein FliF [Acidovorax av... 389 7e-106
gb|EDA95724.1| hypothetical protein GOS_1906171 [marine metagenome] 388 2e-105
ref|YP_995905.1| flagellar M-ring protein FliF [Verminephrobacte... 388 2e-105
ref|YP_001561669.1| flagellar M-ring protein FliF [Delftia acido... 386 5e-105
ref|YP_004485970.1| flagellar M-ring protein FliF [Delftia sp. C... 384 2e-104
ref|YP_003761358.1| flagellar M-ring protein FliF [Nitrosococcus... 381 2e-103
ref|ZP_03545403.1| flagellar M-ring protein FliF [Comamonas test... 380 5e-103
gb|EAY73221.1| hypothetical protein OsI_01094 [Oryza sativa Indi... 379 8e-103
ref|YP_344347.1| flagellar FliF M-ring protein [Nitrosococcus oc... 377 2e-102
emb|CBA31986.1| hypothetical protein Csp_D29860 [Curvibacter put... 377 2e-102
ref|YP_004128452.1| flagellar m-ring protein flif [Alicycliphilu... 376 6e-102
ref|YP_003276500.1| flagellar M-ring protein FliF [Comamonas tes... 375 8e-102
ref|YP_001790052.1| flagellar M-ring protein FliF [Leptothrix ch... 375 1e-101
gb|EGD04395.1| flagellar MS-ring protein [Burkholderia sp. TJI49] 374 3e-101
ref|YP_001019762.1| flagellar biosynthesis lipoprotein [Methylib... 372 8e-101
ref|YP_521832.1| flagellar M-ring protein FliF [Rhodoferax ferri... 371 2e-100
ref|ZP_08403040.1| flagellar M-ring protein FliF [Rubrivivax ben... 368 2e-99
ref|ZP_08535268.1| flagellar biosynthesis/type III secretory pat... 368 2e-99
ref|YP_003527820.1| flagellar M-ring protein FliF [Nitrosococcus... 368 2e-99
ref|YP_003642933.1| flagellar M-ring protein FliF [Thiomonas int... 365 8e-99
ref|YP_002889875.1| flagellar MS-ring protein [Thauera sp. MZ1T]... 363 3e-98
emb|CAZ88225.1| putative Flagellar M-ring protein FliF [Thiomona... 362 7e-98
ref|YP_003613786.1| flagellar M-ring protein [Enterobacter cloac... 360 3e-97
ref|ZP_03803237.1| hypothetical protein PROPEN_01592 [Proteus pe... 360 5e-97
gb|EFZ60306.1| flagellar M-ring protein domain protein [Escheric... 353 5e-95
gb|EFZ71738.1| flagellar M-ring protein domain protein [Escheric... 349 1e-93
ref|ZP_08485753.1| flagellar M-ring protein FliF [Methylomicrobi... 345 1e-92
ref|NP_777699.1| flagellar M-ring protein [Buchnera aphidicola s... 345 2e-92
ref|YP_391708.1| flagellar M-ring protein FliF [Thiomicrospira c... 340 4e-91
ref|YP_003262337.1| flagellar M-ring protein FliF [Halothiobacil... 335 2e-89
ref|YP_002514037.1| flagellar FliF M-ring protein [Thioalkalivib... 333 4e-89
ref|YP_003444876.1| flagellar M-ring protein FliF [Allochromatiu... 331 2e-88
dbj|BAA14027.1| FliF [Shigella boydii] 330 4e-88
ref|YP_004480778.1| flagellar M-ring protein FliF [Marinomonas p... 328 2e-87
ref|ZP_07653103.1| flagellar M-ring protein FliF [Methylobacter ... 327 3e-87
ref|ZP_01167395.1| flagellar M-ring protein [Oceanospirillum sp.... 327 4e-87
ref|ZP_01075384.1| flagellar M-ring protein [Marinomonas sp. MED... 326 5e-87
ref|YP_004513835.1| flagellar M-ring protein FliF [Methylomonas ... 324 2e-86
ref|YP_741553.1| flagellar M-ring protein FliF [Alkalilimnicola ... 324 3e-86
ref|YP_001342286.1| flagellar MS-ring protein [Marinomonas sp. M... 317 3e-84
ref|YP_003812385.1| Flagellar basal-body M-ring protein [gamma p... 317 6e-84
ref|YP_001670156.1| flagellar MS-ring protein [Pseudomonas putid... 316 8e-84
ref|YP_001982191.1| flagellar MS-ring protein [Cellvibrio japoni... 315 1e-83
ref|ZP_05293421.1| Flagellar M-ring protein fliF [Acidithiobacil... 314 2e-83
ref|YP_258764.1| flagellar MS-ring protein [Pseudomonas fluoresc... 314 3e-83
ref|YP_609319.1| flagellar MS-ring protein [Pseudomonas entomoph... 313 4e-83
ref|ZP_01128440.1| flagellar M-ring protein [Nitrococcus mobilis... 313 4e-83
gb|ADR59162.1| FliF [Pseudomonas putida BIRD-1] 311 2e-82
ref|ZP_08328599.1| Flagellar M-ring protein fliF [gamma proteoba... 311 2e-82
ref|YP_127062.1| flagellar MS-ring protein [Legionella pneumophi... 311 2e-82
ref|NP_746483.1| flagellar MS-ring protein [Pseudomonas putida K... 311 3e-82
ref|YP_001266839.1| flagellar MS-ring protein [Pseudomonas putid... 310 4e-82
ref|YP_001349624.1| flagellar MS-ring protein [Pseudomonas aerug... 309 9e-82
ref|YP_124042.1| flagellar MS-ring protein [Legionella pneumophi... 308 1e-81
ref|YP_095786.1| flagellar MS-ring protein [Legionella pneumophi... 308 2e-81
ref|YP_003619051.1| flagellar M-ring protein FliF [Legionella pn... 308 3e-81
ref|NP_249792.1| flagellar MS-ring protein [Pseudomonas aerugino... 307 3e-81
ref|YP_003460403.1| flagellar M-ring protein FliF [Thioalkalivib... 307 3e-81
ref|ZP_04932792.1| Flagella M-ring outer membrane protein precur... 307 3e-81
ref|YP_002441804.1| flagellar MS-ring protein [Pseudomonas aerug... 306 6e-81
gb|AAB06801.1| flagellar MS ring [Pseudomonas aeruginosa] 305 1e-80
ref|YP_004195656.1| flagellar M-ring protein FliF [Desulfobulbus... 301 1e-79
ref|YP_004352677.1| flagellar MS-ring protein [Pseudomonas brass... 301 2e-79
ref|YP_527660.1| flagellar MS-ring protein [Saccharophagus degra... 301 3e-79
gb|EFS14572.1| flagellar M-ring domain protein [Shigella flexner... 300 6e-79
gb|EFW85366.1| flagellar MS-ring protein [Pseudomonas syringae p... 299 1e-78
gb|EFW81183.1| flagellar MS-ring protein [Pseudomonas syringae p... 299 1e-78
ref|YP_002248115.1| flagellar M-ring protein FliF [Thermodesulfo... 298 1e-78
ref|YP_347268.1| flagellar MS-ring protein [Pseudomonas fluoresc... 298 2e-78
ref|ZP_06460738.1| flagellar MS-ring protein [Pseudomonas syring... 298 2e-78
ref|YP_275541.1| flagellar MS-ring protein [Pseudomonas syringae... 296 7e-78
ref|YP_001173082.1| flagellar MS-ring protein [Pseudomonas stutz... 296 7e-78
gb|AEA84579.1| flagellar MS-ring protein [Pseudomonas stutzeri D... 296 9e-78
ref|ZP_01895617.1| flagellar M-ring protein FliF [Marinobacter a... 295 2e-77
ref|YP_001750545.1| flagellar MS-ring protein [Pseudomonas putid... 293 5e-77
ref|NP_791781.1| flagellar M-ring protein FliF [Pseudomonas syri... 293 5e-77
ref|YP_004051855.1| flagellar m-ring protein flif [Calditerrivib... 293 6e-77
gb|EGH10159.1| flagellar MS-ring protein [Pseudomonas syringae p... 293 6e-77
gb|EGH97060.1| flagellar MS-ring protein [Pseudomonas syringae p... 292 9e-77
gb|ADP98090.1| flagellar MS-ring protein [Marinobacter adhaerens... 291 2e-76
gb|EGH72501.1| flagellar MS-ring protein [Pseudomonas syringae p... 291 3e-76
ref|YP_236527.1| flagellar MS-ring protein [Pseudomonas syringae... 291 3e-76
gb|EGH61480.1| flagellar MS-ring protein [Pseudomonas syringae p... 291 3e-76
ref|YP_436296.1| flagellar MS-ring protein [Hahella chejuensis K... 290 3e-76
ref|YP_003072887.1| flagellar MS-ring protein [Teredinibacter tu... 290 4e-76
ref|ZP_01616672.1| flagellar M-ring protein FliF [marine gamma p... 290 4e-76
ref|YP_004473989.1| flagellar M-ring protein FliF [Pseudomonas f... 290 5e-76
ref|YP_003495772.1| flagellar M-ring protein FliF [Deferribacter... 289 8e-76
ref|YP_002140626.1| flagellar M-ring mounting plate protein FliF... 288 1e-75
ref|ZP_01735998.1| flagellar M-ring protein [Marinobacter sp. EL... 288 2e-75
gb|EGH54008.1| flagellar MS-ring protein [Pseudomonas syringae C... 288 2e-75
ref|ZP_03370869.1| flagellar MS-ring protein [Salmonella enteric... 287 3e-75
ref|ZP_01306802.1| flagellar M-ring protein [Oceanobacter sp. RE... 286 5e-75
ref|YP_004314290.1| flagellar M-ring protein FliF [Marinomonas m... 286 6e-75
ref|ZP_07776768.1| flagellar M-ring protein FliF [Pseudomonas fl... 286 6e-75
gb|AAW82147.1| FliF [Stenotrophomonas maltophilia] 286 7e-75
ref|YP_002873972.1| flagellar MS-ring protein [Pseudomonas fluor... 285 1e-74
ref|ZP_03383394.1| flagellar MS-ring protein [Salmonella enteric... 285 2e-74
ref|YP_001232929.1| flagellar M-ring protein FliF [Geobacter ura... 284 4e-74
ref|ZP_01102001.1| flagellar M-ring protein FliF [Congregibacter... 283 4e-74
ref|YP_461019.1| flagellar M-ring protein [Syntrophus aciditroph... 283 5e-74
ref|YP_003797926.1| flagellar M-ring protein FliF [Candidatus Ni... 283 6e-74
ref|YP_001972084.1| flagellar MS-ring protein [Stenotrophomonas ... 283 7e-74
ref|YP_004146575.1| flagellar M-ring protein FliF [Pseudoxanthom... 283 7e-74
ref|YP_959265.1| flagellar MS-ring protein [Marinobacter aquaeol... 283 9e-74
ref|ZP_07262235.1| flagellar MS-ring protein [Pseudomonas syring... 282 1e-73
ref|ZP_05129065.1| flagellar M-ring protein FliF [gamma proteoba... 281 2e-73
ref|ZP_04587695.1| flagellar MS-ring protein [Pseudomonas syring... 281 3e-73
ref|ZP_01312590.1| flagellar M-ring protein FliF [Desulfuromonas... 279 8e-73
gb|EBB47446.1| hypothetical protein GOS_227448 [marine metagenome] 279 9e-73
ref|YP_004281927.1| flagellar M-ring protein FliF [Desulfurobact... 279 1e-72
ref|YP_001188312.1| flagellar MS-ring protein [Pseudomonas mendo... 278 1e-72
ref|YP_004200958.1| flagellar M-ring protein FliF [Geobacter sp.... 278 1e-72
ref|ZP_03656254.1| flagellar MS-ring protein [Helicobacter canad... 278 1e-72
emb|CBX29787.1| hypothetical protein N47_F14820 [uncultured Desu... 278 2e-72
ref|YP_003023697.1| flagellar M-ring protein FliF [Geobacter sp.... 277 3e-72
ref|ZP_03342498.1| flagellar MS-ring protein [Salmonella enteric... 277 5e-72
ref|NP_951469.1| flagellar M-ring protein FliF [Geobacter sulfur... 276 8e-72
ref|ZP_05134806.1| flagellar M-ring protein FliF [Stenotrophomon... 276 1e-71
ref|YP_386051.1| flagellar FliF M-ring protein [Geobacter metall... 275 1e-71
ref|YP_903076.1| flagellar M-ring protein FliF [Pelobacter propi... 275 1e-71
emb|CBE68814.1| Flagellar basal body M-ring protein [NC10 bacter... 275 2e-71
ref|YP_002607498.1| flagellar MS-ring protein [Nautilia profundi... 275 2e-71
ref|YP_002535964.1| flagellar M-ring protein FliF [Geobacter sp.... 275 2e-71
ref|YP_001953530.1| flagellar M-ring protein FliF [Geobacter lov... 274 3e-71
ref|YP_356611.1| flagellar M-ring protein FliF [Pelobacter carbi... 273 7e-71
ref|YP_003375891.1| flagellar biosynthesis lipoprotein flif [Xan... 273 9e-71
ref|NP_908101.1| flagellar MS-ring protein [Wolinella succinogen... 273 9e-71
ref|ZP_08182496.1| flagellar basal-body M-ring protein/flagellar... 272 1e-70
ref|ZP_05109449.1| flagellar MS-ring protein [Legionella drancou... 272 2e-70
ref|YP_003517167.1| flagellar M-ring protein [Helicobacter muste... 271 2e-70
ref|YP_002028267.1| flagellar MS-ring protein [Stenotrophomonas ... 270 5e-70
ref|ZP_08180454.1| flagellar basal-body M-ring protein/flagellar... 270 6e-70
ref|ZP_04809613.1| flagellar basal-body m-ring protein flif [Hel... 270 7e-70
ref|YP_001002087.1| flagellar M-ring protein FliF [Halorhodospir... 270 8e-70
ref|ZP_08423066.1| flagellar M-ring protein FliF [Desulfovibrio ... 269 1e-69
ref|YP_363729.1| flagellar MS-ring protein [Xanthomonas campestr... 268 2e-69
ref|ZP_01871555.1| flagellar M-ring protein [Caminibacter mediat... 267 4e-69
ref|ZP_05638961.1| flagellar MS-ring protein [Pseudomonas syring... 266 6e-69
ref|YP_004379632.1| flagellar MS-ring protein [Pseudomonas mendo... 266 8e-69
gb|EGH21722.1| flagellar MS-ring protein [Pseudomonas syringae p... 266 8e-69
ref|ZP_06729461.1| flagellar protein [Xanthomonas fuscans subsp.... 265 1e-68
ref|YP_392988.1| flagellar MS-ring protein [Sulfurimonas denitri... 265 2e-68
ref|ZP_04583450.1| flagellar basal-body m-ring protein flif [Hel... 265 2e-68
ref|NP_642280.1| flagellar MS-ring protein [Xanthomonas axonopod... 264 3e-68
ref|ZP_06487662.1| flagellar MS-ring protein [Xanthomonas campes... 264 3e-68
ref|ZP_02243239.1| flagellar MS-ring protein [Xanthomonas oryzae... 263 9e-68
gb|EDC95811.1| hypothetical protein GOS_1384600 [marine metagenome] 262 1e-67
ref|ZP_01287892.1| Flagellar FliF M-ring protein [delta proteoba... 262 1e-67
ref|YP_201240.1| flagellar MS-ring protein [Xanthomonas oryzae p... 262 1e-67
gb|EBQ48802.1| hypothetical protein GOS_7743838 [marine metagenome] 262 2e-67
ref|ZP_06542144.1| flagellar MS-ring protein [Salmonella enteric... 261 3e-67
gb|ACX98963.1| flagellar M-ring protein FliF [Helicobacter pylor... 260 5e-67
ref|ZP_01291482.1| Flagellar FliF M-ring protein [delta proteoba... 259 6e-67
ref|NP_207149.1| flagellar MS-ring protein [Helicobacter pylori ... 259 9e-67
ref|YP_003729241.1| flagellar M-ring protein FliF [Helicobacter ... 258 1e-66
ref|ZP_03437076.1| hypothetical protein HPB128_21g129 [Helicobac... 258 2e-66
ref|YP_002300982.1| flagellar MS-ring protein [Helicobacter pylo... 258 2e-66
gb|ADU82797.1| flagellar MS-ring protein [Helicobacter pylori Li... 258 2e-66
gb|ADU40720.1| flagellar M-ring protein FliF [Helicobacter pylor... 258 2e-66
ref|YP_003928281.1| flagellar MS-ring protein [Helicobacter pylo... 258 2e-66
ref|YP_003926647.1| flagellar MS-ring protein [Helicobacter pylo... 258 2e-66
ref|ZP_03438790.1| hypothetical protein HP9810_9g112 [Helicobact... 258 2e-66
gb|ADI34455.1| flagellar M-ring protein FliF [Helicobacter pylor... 258 2e-66
ref|YP_001909843.1| flagellar MS-ring protein [Helicobacter pylo... 258 3e-66
gb|ADU81225.1| flagellar MS-ring protein [Helicobacter pylori Ga... 258 3e-66
ref|YP_002265960.1| flagellar basal-body M-ring protein [Helicob... 258 3e-66
ref|YP_627087.1| flagellar MS-ring protein [Helicobacter pylori ... 257 3e-66
ref|YP_003057147.1| flagellar MS-ring protein [Helicobacter pylo... 257 4e-66
ref|YP_003197444.1| flagellar M-ring protein FliF [Desulfohalobi... 257 4e-66
ref|YP_664742.1| flagellar MS-ring protein [Helicobacter acinony... 257 4e-66
ref|NP_223044.1| flagellar MS-ring protein [Helicobacter pylori ... 257 5e-66
gb|ADZ51036.1| Flagellar M-ring protein [Helicobacter pylori 201... 256 5e-66
dbj|BAJ59475.1| flagellar MS-ring protein [Helicobacter pylori F57] 256 6e-66
gb|ACX97551.1| flagellar basal-body M-ring protein [Helicobacter... 256 6e-66
ref|ZP_08110414.1| flagellar M-ring protein FliF [Desulfovibrio ... 256 7e-66
gb|ADU79570.1| flagellar MS-ring protein [Helicobacter pylori In... 256 9e-66
dbj|BAJ58540.1| flagellar MS-ring protein [Helicobacter pylori F32] 256 9e-66
ref|YP_003806876.1| flagellar M-ring protein FliF [Desulfarculus... 255 1e-65
ref|YP_864202.1| flagellar M-ring protein FliF [Magnetococcus sp... 255 2e-65
ref|YP_003505032.1| flagellar M-ring protein FliF [Denitrovibrio... 254 2e-65
gb|ADU84370.1| flagellar MS-ring protein [Helicobacter pylori So... 254 2e-65
ref|YP_004152053.1| flagellar M-ring protein FliF [Thermovibrio ... 254 3e-65
ref|YP_003303291.1| flagellar M-ring protein FliF [Sulfurospiril... 254 4e-65
gb|ADN79489.1| flagellar M-ring protein [Helicobacter pylori 908] 253 6e-65
ref|YP_009537.1| flagellar M-ring protein FliF [Desulfovibrio vu... 253 6e-65
ref|YP_968107.1| flagellar M-ring protein FliF [Desulfovibrio vu... 253 6e-65
ref|YP_004072985.1| Flagellar basal-body M-ring protein FliF [He... 253 6e-65
ref|YP_002990755.1| flagellar M-ring protein FliF [Desulfovibrio... 253 7e-65
ref|NP_637291.1| flagellar MS-ring protein [Xanthomonas campestr... 253 8e-65
ref|YP_002604951.1| FliF [Desulfobacterium autotrophicum HRM2] >... 253 9e-65
ref|YP_003159520.1| flagellar M-ring protein FliF [Desulfomicrob... 252 1e-64
ref|YP_004113483.1| flagellar M-ring protein FliF [Desulfurispir... 251 2e-64
ref|YP_002730505.1| flagellar M-ring protein FliF [Persephonella... 251 3e-64
ref|YP_004626631.1| flagellar M-ring protein FliF [Thermodesulfa... 250 4e-64
ref|ZP_08053893.1| flagellar MS-ring protein [Helicobacter suis ... 249 1e-63
ref|YP_004060778.1| flagellar m-ring protein flif [Sulfuricurvum... 249 1e-63
ref|YP_821637.1| flagellar M-ring protein FliF [Candidatus Solib... 247 4e-63
ref|ZP_02176742.1| Flagellar M-ring protein [Hydrogenivirga sp. ... 247 5e-63
ref|YP_066392.1| flagellar M-ring protein (FliF) [Desulfotalea p... 246 6e-63
gb|EDI80759.1| hypothetical protein GOS_371648 [marine metagenome] 244 3e-62
ref|YP_662607.1| flagellar MS-ring protein [Pseudoalteromonas at... 244 3e-62
ref|YP_004121766.1| flagellar M-ring protein FliF [Desulfovibrio... 244 4e-62
ref|YP_002523933.1| flagellar M-ring protein FliF [Thermomicrobi... 243 6e-62
ref|YP_002955882.1| flagellar M-ring protein [Desulfovibrio magn... 243 8e-62
gb|AAZ99737.1| FliFL [Aeromonas hydrophila] 243 8e-62
ref|YP_002297039.1| flagellar MS-ring protein [Rhodospirillum ce... 243 8e-62
ref|YP_001140285.1| flagellar MS-ring protein [Aeromonas salmoni... 243 9e-62
ref|YP_386849.1| flagellar M-ring protein FliF [Desulfovibrio de... 242 1e-61
ref|YP_004433510.1| flagellar M-ring protein FliF [Glaciecola ag... 242 1e-61
ref|ZP_05588855.1| flagellar MS-ring protein [Burkholderia thail... 241 2e-61
ref|ZP_01044545.1| flagellar M-ring protein [Nitrobacter sp. Nb-... 241 2e-61
ref|YP_003892706.1| flagellar M-ring protein FliF [Sulfurimonas ... 241 3e-61
ref|YP_576038.1| flagellar MS-ring protein [Nitrobacter hamburge... 241 3e-61
ref|ZP_05363021.1| flagellar M-ring protein FliF [Campylobacter ... 241 4e-61
gb|EBP70932.1| hypothetical protein GOS_7867187 [marine metagenome] 240 4e-61
gb|EES53011.1| flagellar M-ring protein FliF [Leptospirillum fer... 240 4e-61
gb|ECX04159.1| hypothetical protein GOS_2609724 [marine metagenome] 240 6e-61
ref|ZP_07018045.1| flagellar M-ring protein FliF [Desulfonatrono... 240 6e-61
ref|ZP_07334607.1| flagellar M-ring protein FliF [Desulfovibrio ... 239 7e-61
ref|YP_001466462.1| flagellar MS-ring protein [Campylobacter con... 239 7e-61
gb|EDF52264.1| hypothetical protein GOS_940516 [marine metagenome] 239 7e-61
ref|ZP_01452408.1| flagellar M-ring protein FliF [Mariprofundus ... 239 9e-61
ref|YP_003318810.1| flagellar M-ring protein FliF [Sphaerobacter... 239 1e-60
gb|ECZ20948.1| hypothetical protein GOS_2223071 [marine metagenome] 239 1e-60
ref|YP_001356095.1| flagellar M-ring protein FliF [Nitratiruptor... 239 1e-60
gb|EBC65649.1| hypothetical protein GOS_34648 [marine metagenome] 238 1e-60
ref|YP_002429840.1| flagellar M-ring protein FliF [Desulfatibaci... 238 2e-60
ref|ZP_06370492.1| flagellar M-ring protein FliF [Desulfovibrio ... 238 2e-60
ref|YP_002575925.1| flagellar MS-ring protein FliF [Campylobacte... 238 2e-60
ref|YP_003913602.1| flagellar M-ring protein FliF [Ferrimonas ba... 238 3e-60
ref|YP_004607576.1| flagellar M-ring protein FliF [Helicobacter ... 237 3e-60
ref|YP_317218.1| flagellar MS-ring protein [Nitrobacter winograd... 237 4e-60
ref|YP_002288208.1| flagellar M-ring protein FliF [Oligotropha c... 237 4e-60
ref|YP_003290076.1| flagellar M-ring protein FliF [Rhodothermus ... 236 7e-60
ref|ZP_07357049.1| flagellar M-ring protein FliF [Desulfovibrio ... 236 7e-60
ref|YP_002436697.1| flagellar M-ring protein FliF [Desulfovibrio... 236 8e-60
ref|YP_003473414.1| flagellar M-ring protein FliF [Thermocrinis ... 236 8e-60
ref|ZP_03609004.1| flagellar M-ring protein FliF [Campylobacter ... 236 9e-60
gb|EBB08368.1| hypothetical protein GOS_291956 [marine metagenome] 236 9e-60
gb|EBE68729.1| hypothetical protein GOS_9721837 [marine metagenome] 236 1e-59
ref|ZP_06373234.1| flagellar M-ring protein [Campylobacter jejun... 236 1e-59
ref|ZP_05114389.1| flagellar M-ring protein FliF [Labrenzia alex... 235 1e-59
ref|ZP_02178948.1| Flagellar M-ring protein [Hydrogenivirga sp. ... 234 2e-59
gb|ECY37401.1| hypothetical protein GOS_2370940 [marine metagenome] 234 3e-59
ref|ZP_01100470.1| flagellar M-ring protein FliF [Campylobacter ... 234 5e-59
ref|ZP_01067454.1| flagellar M-ring protein FliF [Campylobacter ... 234 5e-59
ref|YP_002480151.1| flagellar M-ring protein FliF [Desulfovibrio... 233 5e-59
ref|YP_004438427.1| flagellar M-ring protein FliF [Thermodesulfo... 233 6e-59
ref|ZP_01223286.1| flagellar protein [marine gamma proteobacteri... 233 6e-59
gb|ECV97074.1| hypothetical protein GOS_2803131 [marine metagenome] 233 6e-59
ref|ZP_03725341.1| flagellar M-ring protein FliF [Opitutaceae ba... 233 8e-59
ref|ZP_05072112.1| flagellar M-ring protein FliF [Campylobactera... 233 1e-58
ref|ZP_05083749.1| flagellar M-ring protein FliF [Pseudovibrio s... 232 1e-58
ref|YP_595232.1| flagellar biosynthesis/type III secretory pathw... 232 1e-58
gb|EDZ39634.1| Flagellar M-ring protein FliF [Leptospirillum sp.... 232 1e-58
ref|YP_002729313.1| flagellar M-ring protein FliF [Sulfurihydrog... 231 2e-58
ref|YP_001481871.1| flagellar MS-ring protein [Campylobacter jej... 231 2e-58
ref|YP_178382.1| flagellar MS-ring protein [Campylobacter jejuni... 231 2e-58
ref|ZP_01069713.1| flagellar M-ring protein FliF [Campylobacter ... 231 2e-58
ref|ZP_05588854.1| flagellar MS-ring protein [Burkholderia thail... 231 2e-58
gb|ADO76697.1| flagellar M-ring protein FliF [Halanaerobium prae... 231 3e-58
ref|YP_001398635.1| flagellar MS-ring protein [Campylobacter jej... 231 3e-58
gb|EAY57819.1| Flagellar M-ring protein FliF [Leptospirillum rub... 231 3e-58
ref|YP_003640296.1| flagellar M-ring protein FliF [Thermincola s... 231 3e-58
gb|EDB34296.1| hypothetical protein GOS_1840338 [marine metagenome] 231 4e-58
ref|ZP_01302009.1| flagellar M-Ring protein [Sphingomonas sp. SK... 231 4e-58
gb|EDJ51243.1| hypothetical protein GOS_1682371 [marine metagenome] 231 4e-58
ref|YP_001000028.1| flagellar MS-ring protein [Campylobacter jej... 230 5e-58
ref|ZP_00367588.1| flagellar M-ring protein FliF [Campylobacter ... 230 6e-58
ref|YP_002509433.1| flagellar M-ring protein FliF [Halothermothr... 230 7e-58
ref|ZP_06372705.1| flagellar M-ring protein [Campylobacter jejun... 230 7e-58
ref|YP_001931794.1| flagellar M-ring protein FliF [Sulfurihydrog... 229 8e-58
ref|ZP_01551018.1| flagellar M-ring protein [Stappia aggregata I... 229 8e-58
ref|YP_003450369.1| flagellar M-ring protein [Azospirillum sp. B... 229 8e-58
ref|YP_003828216.1| flagellar M-ring protein FliF [Acetohalobium... 229 9e-58
ref|YP_001817314.1| flagellar M-ring protein FliF [Opitutus terr... 229 1e-57
ref|ZP_01132750.1| flagellar M-ring protein [Pseudoalteromonas t... 229 2e-57
emb|CAI78781.1| flagellar biosynthesis/type III secretory pathwa... 228 2e-57
ref|YP_004069322.1| flagellar MS-ring protein [Pseudoalteromonas... 228 2e-57
ref|YP_002314294.1| flagellar MS-ring protein [Shewanella piezot... 228 2e-57
ref|ZP_07659477.1| flagellar M-ring protein FliF [Roseibium sp. ... 228 2e-57
ref|YP_004340222.1| flagellar M-ring protein FliF [Hippea mariti... 228 2e-57
ref|ZP_03357755.1| flagellar MS-ring protein [Salmonella enteric... 228 3e-57
ref|YP_001676438.1| flagellar MS-ring protein [Shewanella halifa... 228 3e-57
ref|YP_004627104.1| flagellar M-ring protein FliF [Thermodesulfo... 227 4e-57
ref|YP_001471818.1| flagellar MS-ring protein [Shewanella sedimi... 227 5e-57
ref|ZP_06041059.1| flagellar M-ring protein FliF [Vibrio mimicus... 226 6e-57
ref|ZP_01815979.1| flagellar M-ring protein [Vibrionales bacteri... 226 6e-57
gb|EDF69352.1| hypothetical protein GOS_910455 [marine metagenome] 226 7e-57
ref|ZP_05717538.1| flagellar M-ring protein [Vibrio mimicus VM57... 226 7e-57
ref|YP_001499947.1| flagellar MS-ring protein [Shewanella pealea... 226 1e-56
ref|NP_970143.1| flagellar M-ring protein [Bdellovibrio bacterio... 226 1e-56
ref|YP_001237985.1| flagellar MS-ring protein [Bradyrhizobium sp... 225 1e-56
ref|ZP_08389670.1| flagellar M-ring protein FliF [Sphingomonas s... 225 1e-56
ref|YP_339316.1| flagellar MS-ring protein [Pseudoalteromonas ha... 225 1e-56
gb|AAV85779.1| FliF [Azospirillum brasilense] 225 2e-56
gb|ECW31627.1| hypothetical protein GOS_2742789 [marine metagenome] 225 2e-56
ref|ZP_06155871.1| flagellar M-ring protein FliF [Photobacterium... 225 2e-56
gb|EDB76326.1| hypothetical protein GOS_1597378 [marine metagenome] 225 2e-56
gb|EDF20203.1| hypothetical protein GOS_996917 [marine metagenome] 225 2e-56
gb|EDJ54985.1| hypothetical protein GOS_1675847 [marine metagenome] 225 2e-56
gb|EDC83731.1| hypothetical protein GOS_1405957 [marine metagenome] 224 2e-56
ref|YP_001167839.1| flagellar M-ring protein FliF [Rhodobacter s... 224 2e-56
gb|EDJ53438.1| hypothetical protein GOS_1678580 [marine metagenome] 224 3e-56
gb|EDJ18778.1| hypothetical protein GOS_1739746 [marine metagenome] 224 3e-56
gb|ECV90214.1| hypothetical protein GOS_2815030 [marine metagenome] 224 3e-56
gb|EBC03223.1| hypothetical protein GOS_135430 [marine metagenome] 224 4e-56
gb|EGH30844.1| flagellar MS-ring protein [Pseudomonas syringae p... 224 4e-56
gb|ECX85957.1| hypothetical protein GOS_2463024 [marine metagenome] 224 4e-56
ref|ZP_05719596.1| flagellar M-ring protein [Vibrio mimicus VM60... 223 6e-56
ref|ZP_01158857.1| flagellar M-ring protein [Photobacterium sp. ... 223 1e-55
ref|YP_004068016.1| flagellar MS-ring protein FliF [Pseudoaltero... 223 1e-55
ref|YP_003912318.1| flagellar M-ring protein FliF [Ferrimonas ba... 222 1e-55
ref|YP_003546529.1| flagellar M-ring protein FliF [Sphingobium j... 222 1e-55
ref|YP_779901.1| flagellar MS-ring protein [Rhodopseudomonas pal... 222 1e-55
ref|YP_004110470.1| flagellar M-ring protein FliF [Rhodopseudomo... 222 2e-55
ref|YP_425636.1| flagellar MS-ring protein [Rhodospirillum rubru... 222 2e-55
ref|ZP_01897431.1| flagellar M-ring protein [Moritella sp. PE36]... 221 2e-55
gb|AAZ95839.1| FliF [Aeromonas hydrophila] 221 3e-55
ref|YP_855904.1| flagellar MS-ring protein [Aeromonas hydrophila... 221 3e-55
ref|YP_001990472.1| flagellar MS-ring protein [Rhodopseudomonas ... 221 4e-55
ref|ZP_01233192.1| flagellar M-ring protein [Vibrio angustum S14... 220 4e-55
ref|ZP_07744497.1| flagellar MS-ring protein [Vibrio caribbenthi... 220 5e-55
gb|EBE91809.1| hypothetical protein GOS_9683101 [marine metagenome] 220 6e-55
ref|NP_946615.2| flagellar MS-ring protein [Rhodopseudomonas pal... 220 6e-55
ref|ZP_01235735.1| flagellar M-ring protein [Vibrio angustum S14... 220 6e-55
ref|YP_002296446.1| flagellar M-ring protein FliF [Rhodospirillu... 220 6e-55
ref|YP_003819743.1| flagellar M-ring protein FliF [Brevundimonas... 220 7e-55
ref|ZP_08311591.1| flagellar M-ring protein FliF [Photobacterium... 220 7e-55
ref|YP_001261790.1| flagellar M-ring protein FliF [Sphingomonas ... 219 9e-55
gb|EDA77128.1| hypothetical protein GOS_1940259 [marine metagenome] 219 1e-54
gb|EDB26146.1| hypothetical protein GOS_1854703 [marine metagenome] 219 1e-54
ref|ZP_01878567.1| Flagellar FliF M-ring protein [Roseovarius sp... 219 1e-54
ref|ZP_08519986.1| flagellar MS-ring protein [Aeromonas caviae A... 218 2e-54
gb|EDC60854.1| hypothetical protein GOS_1446270 [marine metagenome] 218 3e-54
ref|YP_004589894.1| flagellar basal-body MS-ring and collar prot... 218 3e-54
gb|ADT87388.1| flagellar M-ring protein [Vibrio furnissii NCTC 1... 218 3e-54
emb|CAE26707.1| putative flagellar M-ring protein [Rhodopseudomo... 218 3e-54
ref|YP_961868.1| flagellar MS-ring protein [Shewanella sp. W3-18... 218 3e-54
ref|YP_001051277.1| flagellar MS-ring protein [Shewanella baltic... 218 3e-54
ref|ZP_01869421.1| flagellar M-ring protein [Vibrio shilonii AK1... 217 4e-54
ref|ZP_01161924.1| flagellar M-ring protein [Photobacterium sp. ... 217 4e-54
ref|YP_155589.1| flagellar MS-ring protein [Idiomarina loihiensi... 217 4e-54
ref|YP_001367133.1| flagellar MS-ring protein [Shewanella baltic... 217 4e-54
ref|ZP_05897894.1| flagellar M-ring protein FliF [Selenomonas sp... 217 5e-54
gb|EDD49902.1| hypothetical protein GOS_1294156 [marine metagenome] 216 7e-54
ref|YP_004467978.1| flagellar MS-ring protein [Alteromonas sp. S... 216 7e-54
ref|YP_484893.1| flagellar MS-ring protein [Rhodopseudomonas pal... 216 7e-54
ref|YP_001052316.1| flagellar MS-ring protein [Shewanella baltic... 216 7e-54
ref|YP_001771886.1| flagellar MS-ring protein [Methylobacterium ... 216 7e-54
ref|YP_003452982.1| flagellar M-ring protein [Azospirillum sp. B... 216 8e-54
ref|YP_001555493.1| flagellar MS-ring protein [Shewanella baltic... 216 8e-54
gb|EDC27565.1| hypothetical protein GOS_1505085 [marine metagenome] 216 8e-54
gb|ECZ87857.1| hypothetical protein GOS_2103894 [marine metagenome] 216 9e-54
ref|ZP_01042102.1| flagellar M-ring protein [Idiomarina baltica ... 216 1e-53
ref|YP_004182612.1| flagellar M-ring protein FliF [Terriglobus s... 216 1e-53
ref|YP_004554796.1| flagellar M-ring protein FliF [Sphingobium c... 216 1e-53
ref|ZP_04716952.1| flagellar MS-ring protein [Alteromonas macleo... 216 1e-53
ref|YP_004391751.1| flagellar M-ring protein FliF [Aeromonas ver... 216 1e-53
ref|ZP_01258477.1| flagellar M-ring protein [Vibrio alginolyticu... 216 1e-53
ref|ZP_02157788.1| flagellar M-ring protein [Shewanella benthica... 215 1e-53
ref|ZP_05877705.1| flagellar M-ring protein FliF [Vibrio furniss... 215 1e-53
gb|EBB93743.1| hypothetical protein GOS_151115 [marine metagenome] 215 1e-53
ref|YP_002310892.1| flagellar MS-ring protein [Shewanella piezot... 215 2e-53
ref|ZP_06179529.1| flagellar M-ring protein [Vibrio alginolyticu... 215 2e-53
ref|ZP_08567262.1| flagellar M-ring protein FliF [Shewanella sp.... 215 2e-53
ref|YP_002753381.1| flagellar M-ring protein FliF [Acidobacteriu... 214 3e-53
ref|YP_001207777.1| flagellar MS-ring protein [Bradyrhizobium sp... 214 3e-53
emb|CAJ73267.1| similar to flagellar MS ring protein [Candidatus... 214 3e-53
ref|ZP_05075197.1| flagellar M-ring protein FliF [Rhodobacterale... 214 3e-53
ref|ZP_04922221.1| flagellar M-ring protein FliF [Vibrio sp. Ex2... 214 4e-53
ref|NP_213805.1| flagellar M-ring protein [Aquifex aeolicus VF5]... 214 4e-53
ref|YP_001757700.1| flagellar MS-ring protein [Methylobacterium ... 214 5e-53
ref|ZP_04659178.1| flagellar M-ring protein FliF [Selenomonas fl... 213 5e-53
ref|ZP_05909569.1| flagellar M-ring protein FliF [Vibrio parahae... 213 7e-53
gb|EGF40271.1| flagellar MS-ring protein [Vibrio parahaemolyticu... 213 8e-53
ref|YP_003825479.1| flagellar M-ring protein FliF [Thermosedimin... 213 8e-53
ref|ZP_08412802.1| FliF [Rhodobacter sphaeroides WS8N] >sp|Q5315... 213 8e-53
ref|ZP_00055409.2| COG1766: Flagellar biosynthesis/type III secr... 213 9e-53
ref|ZP_01988764.1| flagellar M-ring protein FliF [Vibrio parahae... 213 1e-52
ref|ZP_08030473.1| flagellar M-ring protein FliF [Selenomonas ar... 213 1e-52
ref|NP_801046.1| flagellar MS-ring protein [Vibrio parahaemolyti... 213 1e-52
gb|AAO73593.1| lateral flagellar FliF-like M-ring protein [Vibri... 213 1e-52
ref|YP_002525728.1| Flagellar M-ring protein [Rhodobacter sphaer... 213 1e-52
ref|YP_002501185.1| flagellar MS-ring protein [Methylobacterium ... 213 1e-52
ref|YP_353128.1| flagellar FliF M-ring protein [Rhodobacter spha... 212 1e-52
ref|ZP_07025149.1| flagellar M-ring protein FliF [Afipia sp. 1NL... 212 1e-52
ref|YP_419866.1| flagellar MS-ring protein [Magnetospirillum mag... 212 1e-52
ref|ZP_08570253.1| flagellar basal-body M-ring protein/flagellar... 212 2e-52
ref|ZP_07398412.1| flagellar M-ring protein FliF [Selenomonas sp... 212 2e-52
ref|YP_001927206.1| flagellar MS-ring protein [Methylobacterium ... 211 2e-52
ref|YP_001673673.1| flagellar MS-ring protein [Shewanella halifa... 211 2e-52
ref|YP_268244.1| flagellar MS-ring protein [Colwellia psychreryt... 211 2e-52
ref|YP_162369.2| flagellar M-ring protein FliF [Zymomonas mobili... 211 3e-52
ref|YP_004302872.1| flagellar M-ring protein [polymorphum gilvum... 211 3e-52
ref|YP_001408875.1| flagellar MS-ring protein [Campylobacter cur... 211 3e-52
ref|ZP_02194035.1| flagellar M-ring protein [Vibrio sp. AND4] >g... 211 3e-52
gb|AEH62983.1| flagellar M-ring protein FliF [Zymomonas mobilis ... 211 3e-52
gb|EDE01679.1| hypothetical protein GOS_1204579 [marine metagenome] 211 4e-52
ref|YP_446715.1| flagellar M-ring protein FliF [Salinibacter rub... 211 4e-52
ref|YP_570968.1| flagellar MS-ring protein [Rhodopseudomonas pal... 211 4e-52
ref|ZP_07834968.1| flagellar M-ring protein FliF [Thermaerobacte... 210 5e-52
gb|EDB26444.1| hypothetical protein GOS_1854248 [marine metagenome] 210 5e-52
ref|ZP_07893977.1| flagellar M-ring protein FliF [Campylobacter ... 210 5e-52
ref|YP_002120842.1| flagellar M-ring protein FliF [Hydrogenobacu... 210 5e-52
ref|YP_003225761.1| flagellar M-ring protein FliF [Zymomonas mob... 210 5e-52
ref|ZP_00371957.1| flagellar M-ring protein FliF [Campylobacter ... 210 5e-52
ref|ZP_07829529.1| flagellar M-ring protein FliF [Selenomonas sp... 210 5e-52
ref|ZP_01612790.1| flagellar M-ring protein [Alteromonadales bac... 210 5e-52
ref|ZP_06603158.1| flagellar M-ring protein FliF [Selenomonas no... 210 5e-52
ref|ZP_08309018.1| flagellar M-ring protein FliF [Photobacterium... 210 6e-52
ref|YP_001141187.1| flagellar MS-ring protein [Aeromonas salmoni... 210 6e-52
ref|ZP_01002179.1| Flagellar FliF M-ring protein [Loktanella ves... 210 6e-52
gb|ECM17892.1| hypothetical protein GOS_3935785 [marine metagenome] 210 6e-52
ref|YP_003572709.1| flagellar M-ring protein [Salinibacter ruber... 210 6e-52
ref|ZP_03659149.1| flagellar MS-ring protein [Helicobacter cinae... 209 8e-52
ref|ZP_08408996.1| flagellar M-ring protein FliF [Pseudoalteromo... 209 1e-51
ref|YP_003551159.1| flagellar M-ring protein FliF [Candidatus Pu... 209 1e-51
ref|ZP_07739383.1| flagellar M-ring protein FliF [Aminomonas pau... 209 1e-51
gb|EBI49492.1| hypothetical protein GOS_9083063 [marine metagenome] 209 1e-51
gb|EBM04700.1| hypothetical protein GOS_8471899 [marine metagenome] 209 1e-51
ref|YP_001413455.1| flagellar M-ring protein FliF [Parvibaculum ... 209 1e-51
emb|CBW27699.1| flagellar basal-body M-ring protein [Bacteriovor... 209 1e-51
gb|EBD33968.1| hypothetical protein GOS_9945284 [marine metagenome] 209 1e-51
gb|EBE51362.1| hypothetical protein GOS_9751058 [marine metagenome] 209 1e-51
ref|YP_617974.1| flagellar M-ring protein FliF [Sphingopyxis ala... 209 1e-51
ref|YP_003702297.1| flagellar M-ring protein FliF [Syntrophother... 209 2e-51
ref|ZP_08502694.1| flagellar M-ring protein FliF [Centipeda peri... 208 2e-51
ref|YP_004101818.1| flagellar M-ring protein FliF [Thermaerobact... 208 2e-51
gb|EBH37040.1| hypothetical protein GOS_9274249 [marine metagenome] 208 2e-51
ref|YP_004426320.1| flagellar MS-ring protein [Alteromonas macle... 208 2e-51
ref|ZP_01665590.1| flagellar M-ring protein FliF [Thermosinus ca... 208 3e-51
dbj|BAC52264.1| fliF [Bradyrhizobium japonicum USDA 110] 207 5e-51
gb|AAG29859.1|AF313764_2 flagellar M-Ring protein [Zymomonas mob... 207 5e-51
ref|YP_590728.1| flagellar M-ring protein FliF [Candidatus Korib... 207 6e-51
ref|NP_773639.2| flagellar MS-ring protein [Bradyrhizobium japon... 206 7e-51
ref|YP_429632.1| flagellar MS-ring protein [Moorella thermoaceti... 206 7e-51
gb|AAD19741.1| flagellar M-Ring protein [Zymomonas mobilis subsp... 206 7e-51
ref|ZP_05888209.1| flagellar M-ring protein FliF [Vibrio coralli... 206 7e-51
ref|ZP_08139767.1| flagellar MS-ring protein [Pseudomonas sp. TJ... 206 9e-51
ref|ZP_01984395.1| flagellar M-ring protein FliF [Vibrio harveyi... 206 9e-51
ref|ZP_05876900.1| flagellar M-ring protein FliF [Vibrio furniss... 206 1e-50
ref|YP_872600.1| flagellar M-ring protein FliF [Acidothermus cel... 206 1e-50
ref|YP_001447108.1| flagellar MS-ring protein [Vibrio harveyi AT... 206 1e-50
ref|YP_002129705.1| flagellar M-ring protein FliF [Phenylobacter... 206 1e-50
ref|ZP_05944895.1| flagellar M-ring protein FliF [Vibrio orienta... 206 1e-50
gb|EBE71357.1| hypothetical protein GOS_9717554 [marine metagenome] 205 1e-50
ref|ZP_01219037.1| flagellar M-ring protein [Photobacterium prof... 205 1e-50
ref|YP_001759999.1| flagellar MS-ring protein [Shewanella woodyi... 205 1e-50
ref|ZP_06174539.1| flagellar M-ring protein [Vibrio harveyi 1DA3... 205 2e-50
gb|ADT86584.1| Flagellar biosynthesis/type III secretory pathway... 205 2e-50
ref|YP_004264959.1| flagellar M-ring protein FliF [Syntrophobotu... 204 3e-50
ref|YP_530830.2| flagellar MS-ring protein [Rhodopseudomonas pal... 204 4e-50
ref|ZP_06491619.1| flagellar MS-ring protein [Xanthomonas campes... 204 4e-50
ref|YP_002492962.1| flagellar M-ring protein FliF [Anaeromyxobac... 204 5e-50
gb|ABD86511.1| flagellar M-ring protein FliF [Rhodopseudomonas p... 204 5e-50
ref|YP_001641533.1| flagellar MS-ring protein [Methylobacterium ... 203 5e-50
ref|YP_002423164.1| flagellar MS-ring protein [Methylobacterium ... 203 6e-50
ref|ZP_01897120.1| flagellar biosynthesis; basal-body MS(membran... 203 6e-50
ref|YP_003070515.1| basal-body MS biosynthesis protein [Methylob... 203 6e-50
ref|YP_564657.1| flagellar MS-ring protein [Shewanella denitrifi... 203 7e-50
ref|ZP_08188226.1| flagellar basal-body M-ring protein/flagellar... 203 7e-50
ref|YP_921971.1| flagellar M-ring protein FliF [Nocardioides sp.... 203 7e-50
ref|ZP_06440428.1| flagellar M-ring protein FliF [Anaerobaculum ... 203 8e-50
gb|EBI86782.1| hypothetical protein GOS_9020450 [marine metagenome] 203 8e-50
ref|YP_001778279.1| flagellar M-ring protein FliF [Burkholderia ... 202 9e-50
gb|ECW94161.1| hypothetical protein GOS_2628127 [marine metagenome] 202 1e-49
gb|AEI37495.1| flagellar M-ring protein FliF [Zymomonas mobilis ... 202 1e-49
ref|YP_129136.1| flagellar MS-ring protein [Photobacterium profu... 202 1e-49
gb|ECD52025.1| hypothetical protein GOS_3137820 [marine metagenome] 202 2e-49
ref|ZP_03735052.1| flagellar M-ring protein FliF [Dethiobacter a... 202 2e-49
ref|YP_001501223.1| flagellar MS-ring protein [Shewanella pealea... 201 2e-49
ref|YP_002965390.1| flagellar biosynthesis; basal-body MS(membra... 201 2e-49
ref|ZP_08101609.1| flagellar MS-ring protein [Vibrio sinaloensis... 201 3e-49
ref|YP_928172.1| flagellar MS-ring protein [Shewanella amazonens... 201 3e-49
ref|ZP_05885379.1| flagellar M-ring protein FliF [Vibrio coralli... 201 3e-49
ref|YP_001212639.1| flagellar MS-ring protein [Pelotomaculum the... 201 3e-49
gb|EBK01861.1| hypothetical protein GOS_8801937 [marine metagenome] 201 3e-49
gb|EBU25713.1| hypothetical protein GOS_7142195 [marine metagenome] 201 4e-49
gb|EDA46602.1| hypothetical protein GOS_1996017 [marine metagenome] 201 4e-49
ref|ZP_01868146.1| flagellar M-ring protein [Vibrio shilonii AK1... 200 5e-49
ref|ZP_05119027.1| flagellar M-ring protein FliF [Vibrio parahae... 200 5e-49
ref|ZP_06391387.1| flagellar M-ring protein FliF [Dethiosulfovib... 200 5e-49
ref|YP_733418.1| flagellar MS-ring protein [Shewanella sp. MR-4]... 200 6e-49
ref|YP_001189896.1| flagellar MS-ring protein [Pseudomonas mendo... 200 6e-49
ref|YP_868982.1| flagellar MS-ring protein [Shewanella sp. ANA-3... 200 6e-49
ref|YP_464605.1| flagellar M-ring protein FliF [Anaeromyxobacter... 200 7e-49
ref|YP_003190225.1| flagellar MS-ring protein [Desulfotomaculum ... 200 7e-49
gb|AAY87249.1| predicted flagellar basal-body M-ring protein [un... 199 9e-49
ref|YP_001061229.1| flagellar MS-ring protein [Burkholderia pseu... 199 1e-48
ref|ZP_02409148.1| flagellar MS-ring protein [Burkholderia pseud... 199 1e-48
gb|EBJ62248.1| hypothetical protein GOS_8867623 [marine metagenome] 199 1e-48
ref|ZP_05031956.1| flagellar M-ring protein FliF [Brevundimonas ... 199 1e-48
ref|YP_962824.1| flagellar MS-ring protein [Shewanella sp. W3-18... 199 1e-48
ref|ZP_04967153.1| flagellar M-ring protein FliF [Burkholderia p... 199 1e-48
ref|YP_003408110.1| flagellar M-ring protein FliF [Geodermatophi... 199 2e-48
gb|ADV55145.1| flagellar M-ring protein FliF [Shewanella putrefa... 199 2e-48
ref|NP_718783.1| flagellar MS-ring protein [Shewanella oneidensi... 198 2e-48
gb|EBD78207.1| hypothetical protein GOS_9873084 [marine metagenome] 198 2e-48
ref|ZP_03698860.1| flagellar M-ring protein FliF [Lutiella nitro... 198 2e-48
gb|EDA61975.1| hypothetical protein GOS_1968212 [marine metagenome] 198 2e-48
ref|ZP_08098253.1| flagellar MS-ring protein [Vibrio brasiliensi... 198 2e-48
gb|ECX85912.1| hypothetical protein GOS_2463095 [marine metagenome] 198 2e-48
gb|ECQ90654.1| hypothetical protein GOS_3805355 [marine metagenome] 198 3e-48
ref|YP_004565660.1| FliF [Vibrio anguillarum 775] >gb|AEH32618.1... 198 3e-48
ref|ZP_05969368.2| flagellar M-ring protein FliF [Enterobacter c... 198 3e-48
ref|YP_004497557.1| flagellar M-ring protein FliF [Desulfotomacu... 198 3e-48
ref|YP_001917562.1| flagellar M-ring protein FliF [Natranaerobiu... 197 3e-48
ref|ZP_02369518.1| flagellar MS-ring protein [Burkholderia thail... 197 3e-48
gb|EDB67702.1| hypothetical protein GOS_1613482 [marine metagenome] 197 3e-48
ref|YP_003317850.1| flagellar M-ring protein FliF [Thermanaerovi... 197 3e-48
ref|ZP_08114822.1| flagellar M-ring protein FliF [Desulfotomacul... 197 4e-48
gb|ECL88927.1| hypothetical protein GOS_5079941 [marine metagenome] 197 4e-48
ref|ZP_06081034.1| flagellar M-ring protein FliF [Vibrio sp. RC5... 197 4e-48
ref|ZP_01866380.1| flagellar M-ring protein [Vibrio shilonii AK1... 197 5e-48
ref|YP_001043570.1| flagellar M-ring protein FliF [Rhodobacter s... 197 5e-48
gb|EBM11675.1| hypothetical protein GOS_8460485 [marine metagenome] 197 6e-48
ref|YP_001717893.1| flagellar MS-ring protein [Candidatus Desulf... 197 6e-48
ref|YP_003613785.1| flagellar M-ring protein FliF [Enterobacter ... 196 7e-48
ref|YP_004210245.1| flagellar M-ring protein FliF [Acidobacteriu... 196 8e-48
ref|YP_891471.1| flagellar MS-ring protein [Campylobacter fetus ... 196 1e-47
ref|NP_902669.1| flagellar MS-ring protein [Chromobacterium viol... 196 1e-47
gb|ECH85129.1| hypothetical protein GOS_3625455 [marine metagenome] 196 1e-47
gb|EGH47363.1| flagellar MS-ring protein [Pseudomonas syringae p... 196 1e-47
ref|NP_935274.1| flagellar MS-ring protein [Vibrio vulnificus YJ... 196 1e-47
ref|NP_760808.1| flagellar MS-ring protein [Vibrio vulnificus CM... 196 1e-47
ref|ZP_06896667.1| flagellar M-ring protein FliF [Roseomonas cer... 195 2e-47
ref|YP_003363880.1| lateral flagellar M-ring protein [Citrobacte... 195 2e-47
ref|YP_003556181.1| flagellar M-ring protein FliF [Shewanella vi... 195 2e-47
ref|YP_944847.1| flagellar MS-ring protein [Psychromonas ingraha... 195 2e-47
gb|ECX58588.1| hypothetical protein GOS_2511862 [marine metagenome] 195 2e-47
ref|ZP_03803236.1| hypothetical protein PROPEN_01591 [Proteus pe... 195 2e-47
ref|ZP_05924170.1| flagellar M-ring protein FliF [Vibrio sp. RC3... 195 2e-47
ref|YP_001474798.1| flagellar MS-ring protein [Shewanella sedimi... 195 2e-47
gb|EDF16838.1| hypothetical protein GOS_1002895 [marine metagenome] 194 3e-47
ref|ZP_06054204.1| flagellar M-ring protein FliF [Grimontia holl... 194 3e-47
ref|ZP_02383454.1| flagellar MS-ring protein [Burkholderia thail... 194 3e-47
ref|YP_438373.1| flagellar MS-ring protein [Burkholderia thailan... 194 3e-47
ref|ZP_05716138.1| flagellar M-ring protein [Vibrio mimicus VM57... 194 4e-47
gb|EBQ96558.1| hypothetical protein GOS_7670854 [marine metagenome] 194 4e-47
gb|EBB91499.1| hypothetical protein GOS_154915 [marine metagenome] 194 5e-47
ref|YP_749873.1| flagellar MS-ring protein [Shewanella frigidima... 193 6e-47
ref|YP_435216.1| flagellar M-ring protein FliF [Hahella chejuens... 193 7e-47
ref|ZP_06652192.1| flagellar M-ring protein FliF [Escherichia co... 193 8e-47
ref|ZP_08346506.1| flagellar M-ring protein FliF [Escherichia co... 192 1e-46
ref|NP_231764.1| flagellar MS-ring protein [Vibrio cholerae O1 b... 192 1e-46
gb|ECX09645.1| hypothetical protein GOS_2599917 [marine metagenome] 192 1e-46
gb|EFZ76783.1| flagellar M-ring protein FliF [Escherichia coli R... 192 1e-46
gb|EBP57418.1| hypothetical protein GOS_7889733 [marine metagenome] 192 1e-46
ref|ZP_04948384.1| Flagellar biosynthesis/type III secretory pat... 192 1e-46
ref|ZP_01676600.1| flagellar M-ring protein FliF [Vibrio cholera... 192 1e-46
gb|EBF55223.1| hypothetical protein GOS_9579099 [marine metagenome] 192 1e-46
gb|EGB71038.1| flagellar M-ring protein FliF [Escherichia coli T... 192 1e-46
ref|ZP_07151050.1| flagellar M-ring protein FliF [Escherichia co... 192 1e-46
ref|ZP_04962163.1| flagellar M-ring protein FliF [Vibrio cholera... 192 2e-46
ref|YP_001742357.1| flagellar MS-ring protein [Escherichia coli ... 192 2e-46
gb|EDC38165.1| hypothetical protein GOS_1486071 [marine metagenome] 192 2e-46
gb|EDI88064.1| hypothetical protein GOS_1792611 [marine metagenome] 191 2e-46
gb|EBE08518.1| hypothetical protein GOS_9823512 [marine metagenome] 191 3e-46
gb|ECP58893.1| hypothetical protein GOS_5479842 [marine metagenome] 191 4e-46
ref|ZP_04614343.1| Flagellar M-ring protein [Yersinia rohdei ATC... 191 4e-46
ref|YP_001093494.1| flagellar MS-ring protein [Shewanella loihic... 191 4e-46
emb|CAH19122.1| Lateral flagellar M-ring protein (FliF-like) [Es... 191 4e-46
ref|YP_205235.1| flagellar MS-ring protein [Vibrio fischeri ES11... 191 4e-46
gb|ECY60184.1| hypothetical protein GOS_2331598 [marine metagenome] 191 4e-46
gb|AEG35041.1| Flagellar M-ring protein [Escherichia coli NA114] 191 5e-46
ref|ZP_02195742.1| flagellar M-ring protein [Vibrio sp. AND4] >g... 190 5e-46
ref|YP_562333.1| flagellar MS-ring protein [Shewanella denitrifi... 190 5e-46
ref|YP_001454439.1| flagellar MS-ring protein [Citrobacter koser... 190 5e-46
gb|ECG51293.1| hypothetical protein GOS_5449228 [marine metagenome] 190 6e-46
ref|YP_002156678.1| flagellar M-ring protein FliF [Vibrio fische... 190 6e-46
ref|ZP_08266712.1| flagellar M-ring protein FliF [Brevundimonas ... 190 6e-46
ref|YP_753539.1| flagellar M-ring protein FliF [Syntrophomonas w... 190 6e-46
ref|ZP_05294062.1| Flagellar M-ring protein fliF [Acidithiobacil... 190 6e-46
ref|YP_003779192.1| flagellar M-ring protein FliF [Clostridium l... 190 6e-46
ref|ZP_05876641.1| flagellar M-ring protein FliF [Vibrio furniss... 190 7e-46
ref|ZP_06051354.1| flagellar M-ring protein FliF [Grimontia holl... 190 7e-46
ref|ZP_07744602.1| flagellar MS-ring protein [Vibrio caribbenthi... 190 7e-46
ref|ZP_02999326.1| flagellar M-ring protein FliF [Escherichia co... 189 9e-46
gb|EGE66152.1| flagellar M-ring protein FliF [Escherichia coli S... 189 1e-45
ref|ZP_05434079.1| flagellar MS-ring protein [Shigella sp. D9] >... 189 1e-45
ref|ZP_07594790.1| flagellar M-ring protein FliF [Escherichia co... 189 1e-45
ref|ZP_06179818.1| flagellar M-ring protein [Vibrio alginolyticu... 189 2e-45
gb|ECC36462.1| hypothetical protein GOS_4192473 [marine metagenome] 189 2e-45
gb|EDB05744.1| hypothetical protein GOS_1889290 [marine metagenome] 188 2e-45
ref|YP_003227344.1| putative lateral flagellar basal-body M-ring... 188 2e-45
ref|YP_003100133.1| flagellar M-ring protein FliF [Actinosynnema... 188 2e-45
ref|ZP_01986820.1| flagellar M-ring protein FliF [Vibrio harveyi... 188 2e-45
ref|ZP_07246650.1| flagellar M-ring protein FliF [Escherichia co... 188 2e-45
ref|YP_001446338.1| flagellar MS-ring protein [Vibrio harveyi AT... 188 2e-45
gb|EBT89400.1| hypothetical protein GOS_7198381 [marine metagenome] 188 3e-45
ref|ZP_07447513.1| flagellar MS-ring protein [Escherichia coli N... 188 3e-45
ref|YP_002411030.1| flagellar MS-ring protein [Escherichia coli ... 187 3e-45
ref|ZP_08208560.1| flagellar M-ring protein FliF [Novosphingobiu... 187 4e-45
gb|EBA70960.1| hypothetical protein GOS_355809 [marine metagenome] 187 4e-45
ref|YP_802615.1| hypothetical protein BCc_043 [Buchnera aphidico... 187 4e-45
ref|YP_128279.1| flagellar MS-ring protein [Photobacterium profu... 187 4e-45
ref|YP_003594433.1| cyclic nucleotide-binding protein [Caulobact... 187 5e-45
ref|YP_004517154.1| flagellar M-ring protein FliF [Desulfotomacu... 187 6e-45
emb|CBJ37725.1| putative Flagellar M-ring protein FliF [Ralstoni... 187 6e-45
ref|ZP_07097504.1| flagellar M-ring protein FliF [Escherichia co... 187 6e-45
ref|ZP_01064462.1| flagellar M-ring protein [Vibrio sp. MED222] ... 187 6e-45
gb|EDC04130.1| hypothetical protein GOS_1546800 [marine metagenome] 187 6e-45
ref|ZP_04921862.1| flagellar M-ring protein FliF [Vibrio sp. Ex2... 187 7e-45
gb|EDG14161.1| hypothetical protein GOS_833423 [marine metagenome] 186 7e-45
gb|EFZ56696.1| flagellar M-ring protein FliF [Escherichia coli L... 186 7e-45
ref|YP_002416444.1| flagellar MS-ring protein [Vibrio splendidus... 186 7e-45
ref|ZP_00991007.1| flagellar M-ring protein [Vibrio splendidus 1... 186 7e-45
ref|YP_003232801.1| putative lateral flagellar basal-body M-ring... 186 7e-45
ref|YP_003060588.1| flagellar M-ring protein FliF [Hirschia balt... 186 9e-45
gb|EDE91794.1| hypothetical protein GOS_1047561 [marine metagenome] 186 9e-45
gb|AEH50144.1| flagellar M-ring protein FliF [Thermotoga thermar... 186 1e-44
ref|ZP_01258809.1| flagellar M-ring protein [Vibrio alginolyticu... 186 1e-44
ref|ZP_04526926.1| flagellar M-ring protein FliF [Clostridium bu... 186 1e-44
ref|YP_190863.1| flagellar MS-ring protein [Gluconobacter oxydan... 186 1e-44
ref|ZP_01813119.1| flagellar M-ring protein [Vibrionales bacteri... 186 1e-44
ref|YP_001361400.1| flagellar M-ring protein FliF [Kineococcus r... 186 1e-44
ref|YP_004382530.1| flagellar MS-ring protein [Pseudomonas mendo... 186 1e-44
gb|AEA82097.1| flagellar MS-ring protein [Pseudomonas stutzeri D... 186 1e-44
ref|YP_001726328.1| flagellar MS-ring protein [Escherichia coli ... 185 2e-44
gb|ECX86235.1| hypothetical protein GOS_2462474 [marine metagenome] 185 2e-44
ref|ZP_00963769.1| flagellar FliF M-ring protein [Sulfitobacter ... 185 2e-44
gb|EGH47422.1| flagellar MS-ring protein [Pseudomonas syringae p... 185 2e-44
ref|ZP_05059211.1| flagellar M-ring protein FliF [Verrucomicrobi... 185 2e-44
ref|NP_348780.1| flagellar MS-ring protein [Clostridium acetobut... 185 2e-44
ref|YP_004535985.1| flagellar M-ring protein FliF [Novosphingobi... 185 2e-44
ref|ZP_06033973.1| flagellar M-ring protein FliF [Vibrio mimicus... 184 3e-44
gb|ABZ08264.1| putative Secretory protein of YscJ/FliF family pr... 184 3e-44
ref|ZP_08372583.1| flagellar M-ring protein FliF [Escherichia co... 184 3e-44
gb|EBE65041.1| hypothetical protein GOS_9728021 [marine metagenome] 184 3e-44
ref|YP_071839.1| flagellar MS-ring protein [Yersinia pseudotuber... 184 3e-44
gb|EGO63145.1| flagellar M-ring protein FliF [Acetonema longum D... 184 4e-44
ref|ZP_02995221.1| hypothetical protein CLOSPO_02343 [Clostridiu... 184 6e-44
ref|YP_001410344.1| flagellar M-ring protein FliF [Fervidobacter... 183 6e-44
gb|ECV71858.1| hypothetical protein GOS_2847603 [marine metagenome] 183 7e-44
ref|ZP_06175980.1| flagellar M-ring protein [Vibrio harveyi 1DA3... 183 7e-44
ref|NP_860142.1| flagellar MS-ring protein [Helicobacter hepatic... 183 7e-44
ref|YP_001399623.1| flagellar MS-ring protein [Yersinia pseudotu... 183 9e-44
ref|YP_003239972.1| flagellar M-ring protein FliF [Ammonifex deg... 183 9e-44
gb|EBX99139.1| hypothetical protein GOS_6330771 [marine metagenome] 182 1e-43
ref|ZP_06354212.1| flagellar M-ring protein FliF [Citrobacter yo... 182 1e-43
ref|ZP_06861236.1| flagellar MS-ring protein [Citromicrobium bat... 182 1e-43
ref|YP_002334605.1| flagellar M-ring protein FliF [Thermosipho a... 182 1e-43
ref|NP_798628.1| flagellar MS-ring protein [Vibrio parahaemolyti... 182 1e-43
gb|EDE87010.1| hypothetical protein GOS_1055682 [marine metagenome] 182 1e-43
ref|YP_004452198.1| flagellar M-ring protein FliF [Cellulomonas ... 182 1e-43
ref|YP_519222.1| hypothetical protein DSY2989 [Desulfitobacteriu... 182 2e-43
ref|ZP_02910177.1| flagellar M-ring protein FliF [Burkholderia a... 182 2e-43
ref|YP_004353699.1| flagellar M-ring protein [Pseudomonas brassi... 182 2e-43
ref|NP_670762.1| flagellar MS-ring protein [Yersinia pestis KIM ... 182 2e-43
ref|ZP_01444395.1| flagellar M-ring protein [Pelagibaca bermuden... 181 2e-43
ref|YP_001873894.1| flagellar MS-ring protein [Yersinia pseudotu... 181 3e-43
ref|ZP_01625746.1| flagellar M-ring protein [marine gamma proteo... 181 3e-43
gb|EBF29369.1| hypothetical protein GOS_9621525 [marine metagenome] 181 4e-43
ref|YP_002460594.1| flagellar M-ring protein FliF [Desulfitobact... 181 4e-43
ref|YP_001568400.1| flagellar M-ring protein FliF [Petrotoga mob... 180 6e-43
gb|EBD92162.1| hypothetical protein GOS_9850572 [marine metagenome] 180 6e-43
ref|ZP_01862496.1| flagellar M-ring protein FliF [Erythrobacter ... 180 6e-43
gb|ECY66657.1| hypothetical protein GOS_2319685 [marine metagenome] 180 6e-43
gb|EBJ15583.1| hypothetical protein GOS_8971405 [marine metagenome] 180 8e-43
ref|YP_001113743.1| flagellar MS-ring protein [Desulfotomaculum ... 180 8e-43
ref|ZP_08328827.1| Flagellar M-ring protein fliF [gamma proteoba... 179 1e-42
gb|ADG00358.1| fliF; flagellar M-ring protein FliF [Clostridium ... 179 1e-42
gb|ECE26557.1| hypothetical protein GOS_3649828 [marine metagenome] 179 1e-42
emb|CBZ04563.1| flagellar M-ring protein FliF [Clostridium botul... 179 1e-42
ref|YP_001255161.1| flagellar MS-ring protein [Clostridium botul... 179 1e-42
ref|YP_001782279.1| flagellar MS-ring protein [Clostridium botul... 179 1e-42
ref|ZP_02615577.1| flagellar M-ring protein fliF [Clostridium bo... 179 1e-42
gb|EBW30566.1| hypothetical protein GOS_6767451 [marine metagenome] 179 1e-42
ref|YP_003315853.1| flagellar basal-body M-ring protein/flagella... 179 1e-42
gb|EBG61817.1| hypothetical protein GOS_9402902 [marine metagenome] 179 1e-42
gb|EBT79417.1| hypothetical protein GOS_7214836 [marine metagenome] 179 1e-42
ref|ZP_00956642.1| flagellar M-ring protein [Sulfitobacter sp. E... 179 1e-42
gb|EBY23911.1| hypothetical protein GOS_3416921 [marine metagenome] 179 1e-42
gb|EBF62397.1| hypothetical protein GOS_9567420 [marine metagenome] 179 1e-42
gb|ECG51866.1| hypothetical protein GOS_5423902 [marine metagenome] 179 2e-42
ref|YP_002805166.1| flagellar M-ring protein fliF [Clostridium b... 178 2e-42
gb|EBC88254.1| hypothetical protein GOS_10020734 [marine metagen... 178 2e-42
ref|ZP_01215011.1| flagellar M-ring protein [Psychromonas sp. CN... 178 2e-42
ref|YP_001680788.1| flagellar m-ring protein flif, putative [Hel... 178 2e-42
ref|ZP_08264802.1| flagellar M-ring protein FliF [Asticcacaulis ... 178 3e-42
gb|EBQ85127.1| hypothetical protein GOS_7688179 [marine metagenome] 177 4e-42
ref|YP_004299490.1| flagellar M-ring protein [Yersinia enterocol... 177 4e-42
gb|EDJ25121.1| hypothetical protein GOS_1728706 [marine metagenome] 177 4e-42
sp|Q04954.1|FLIF_CAUCR RecName: Full=Flagellar M-ring protein >g... 177 4e-42
ref|NP_419721.2| flagellar MS-ring protein [Caulobacter crescent... 177 5e-42
ref|ZP_02617933.1| flagellar M-ring protein FliF [Clostridium bo... 177 5e-42
ref|ZP_02367490.1| flagellar MS-ring protein [Burkholderia oklah... 177 5e-42
ref|YP_001787983.1| flagellar MS-ring protein [Clostridium botul... 177 5e-42
ref|YP_004544798.1| flagellar M-ring protein FliF [Desulfotomacu... 177 6e-42
gb|EDJ49337.1| hypothetical protein GOS_1685506 [marine metagenome] 177 6e-42
ref|ZP_05050102.1| flagellar M-ring protein FliF [Octadecabacter... 176 7e-42
ref|YP_076830.1| flagellar basal-body M-ring protein [Symbiobact... 176 8e-42
ref|ZP_07395721.1| flagellar MS-ring protein [Candidatus Regiell... 176 9e-42
ref|YP_755917.1| flagellar MS-ring protein [Maricaulis maris MCS... 176 9e-42
ref|ZP_02360107.1| flagellar MS-ring protein [Burkholderia oklah... 176 1e-41
gb|ECA49242.1| hypothetical protein GOS_4635134 [marine metagenome] 176 1e-41
ref|ZP_02730987.1| Flagellar FliF M-ring protein [Gemmata obscur... 176 1e-41
gb|EBB92948.1| hypothetical protein GOS_152486 [marine metagenome] 176 1e-41
ref|YP_001770065.1| flagellar MS-ring protein [Methylobacterium ... 175 2e-41
ref|YP_004283750.1| flagellar M-ring protein FliF [Acidiphilium ... 175 2e-41
ref|YP_004086431.1| flagellar m-ring protein flif [Asticcacaulis... 175 2e-41
ref|YP_001234602.1| flagellar M-ring protein FliF [Acidiphilium ... 175 2e-41
ref|YP_003843222.1| flagellar M-ring protein FliF [Clostridium c... 175 2e-41
gb|ECL68632.1| hypothetical protein GOS_5902651 [marine metagenome] 175 2e-41
gb|ECH73811.1| hypothetical protein GOS_4069025 [marine metagenome] 175 2e-41
gb|EBX89963.1| hypothetical protein GOS_6515492 [marine metagenome] 175 2e-41
gb|ECN54723.1| hypothetical protein GOS_5483012 [marine metagenome] 175 2e-41
ref|ZP_06860264.1| flagellar M-ring protein FliF [Citromicrobium... 175 2e-41
ref|YP_004065890.1| flagellar M-ring protein FliF [Campylobacter... 174 3e-41
ref|YP_001601921.1| flagellar MS-ring protein [Gluconacetobacter... 174 3e-41
ref|YP_003656658.1| flagellar M-ring protein FliF [Arcobacter ni... 174 3e-41
gb|ECV76540.1| hypothetical protein GOS_2839349 [marine metagenome] 174 3e-41
gb|EBL91637.1| hypothetical protein GOS_8493229 [marine metagenome] 174 3e-41
ref|ZP_08211050.1| flagellar M-ring protein FliF [Thermoanaeroba... 174 4e-41
ref|YP_002277798.1| flagellar MS-ring protein [Gluconacetobacter... 174 4e-41
gb|EBV62105.1| hypothetical protein GOS_6876717 [marine metagenome] 174 4e-41
gb|EDF60374.1| hypothetical protein GOS_926037 [marine metagenome] 174 5e-41
ref|YP_004158742.1| flagellar M-ring protein [Bartonella clarrid... 174 5e-41
gb|EBN70730.1| hypothetical protein GOS_8201604 [marine metagenome] 174 6e-41
gb|EBY38003.1| hypothetical protein GOS_6088726 [marine metagenome] 173 7e-41
ref|YP_001885041.1| flagellar MS-ring protein [Clostridium botul... 173 7e-41
gb|EBQ13222.1| hypothetical protein GOS_7798122 [marine metagenome] 173 7e-41
emb|CBX72503.1| hypothetical protein YEW_GP28340 [Yersinia enter... 173 8e-41
ref|YP_359840.1| flagellar MS-ring protein [Carboxydothermus hyd... 173 8e-41
gb|ABZ06520.1| putative Secretory protein of YscJ/FliF family pr... 173 8e-41
ref|ZP_03386014.1| flagellar MS-ring protein [Salmonella enteric... 173 9e-41
gb|EBB55462.1| hypothetical protein GOS_213889 [marine metagenome] 172 1e-40
ref|YP_001595075.1| flagellar MS-ring protein [Brucella canis AT... 172 1e-40
gb|EBJ79138.1| hypothetical protein GOS_8839127 [marine metagenome] 172 1e-40
ref|ZP_05839176.1| flagellar M-ring protein FliF [Brucella suis ... 172 1e-40
ref|YP_001663315.1| flagellar M-ring protein FliF [Thermoanaerob... 172 1e-40
ref|YP_004475098.1| flagellar M-ring protein FliF [Pseudomonas f... 172 1e-40
gb|ECL00518.1| hypothetical protein GOS_5089462 [marine metagenome] 172 1e-40
ref|ZP_04623342.1| Flagellar M-ring protein [Yersinia kristensen... 172 2e-40
ref|NP_228036.1| flagellar M-ring protein [Thermotoga maritima M... 172 2e-40
gb|EBM88764.1| hypothetical protein GOS_8336589 [marine metagenome] 172 2e-40
ref|ZP_07478000.1| flagellar M-ring protein FliF [Brucella sp. B... 172 2e-40
gb|EBU99080.1| hypothetical protein GOS_6973616 [marine metagenome] 172 2e-40
ref|ZP_05491625.1| flagellar M-ring protein FliF [Thermoanaeroba... 172 2e-40
gb|EBF64790.1| hypothetical protein GOS_9563533 [marine metagenome] 172 2e-40
ref|YP_001665247.1| flagellar M-ring protein FliF [Thermoanaerob... 172 2e-40
sp|Q8YDM4.3|FLIF_BRUME RecName: Full=Flagellar M-ring protein 172 2e-40
gb|ECB41168.1| hypothetical protein GOS_4466504 [marine metagenome] 171 2e-40
ref|YP_002534006.1| Flagellar M-ring protein [Thermotoga neapoli... 171 2e-40
ref|YP_003161968.1| flagellar M-ring protein FliF [Jonesia denit... 171 2e-40
gb|EGE59930.1| flagellar M-ring protein [Rhizobium etli CNPAF512] 171 2e-40
ref|ZP_05934101.1| flagellar M-ring protein FliF [Brucella ceti ... 171 3e-40
ref|YP_001976890.1| flagellar M-ring protein [Rhizobium etli CIA... 171 3e-40
ref|YP_468189.1| flagellar MS-ring protein [Rhizobium etli CFN 4... 171 3e-40
ref|ZP_05456229.1| flagellar MS-ring protein [Brucella ceti M490... 171 3e-40
gb|ECO37656.1| hypothetical protein GOS_5708500 [marine metagenome] 171 3e-40
gb|EBQ94513.1| hypothetical protein GOS_7673997 [marine metagenome] 171 3e-40
gb|EDE23848.1| hypothetical protein GOS_1165595 [marine metagenome] 171 4e-40
ref|YP_001932956.1| flagellar MS-ring protein [Brucella abortus ... 171 4e-40
ref|ZP_01041244.1| flagellar M-Ring protein [Erythrobacter sp. N... 171 4e-40
ref|NP_700300.1| flagellar MS-ring protein [Brucella suis 1330] ... 171 4e-40
ref|YP_001244299.1| flagellar M-ring protein FliF [Thermotoga pe... 171 4e-40
ref|YP_004460672.1| flagellar M-ring protein FliF [Tepidanaeroba... 171 4e-40
ref|YP_001258009.1| flagellar MS-ring protein [Brucella ovis ATC... 170 5e-40
ref|ZP_05929732.1| flagellar M-ring protein FliF [Brucella abort... 170 5e-40
gb|ECD83895.1| hypothetical protein GOS_5328304 [marine metagenome] 170 5e-40
ref|ZP_05449992.1| flagellar MS-ring protein [Brucella neotomae ... 170 5e-40
ref|ZP_05156928.1| flagellar MS-ring protein [Brucella abortus b... 170 6e-40
ref|YP_001372729.1| flagellar MS-ring protein [Ochrobactrum anth... 170 7e-40
ref|YP_223817.1| flagellar MS-ring protein [Brucella abortus bv.... 170 8e-40
emb|CBI82820.1| Flagellar M-ring protein [Bartonella schoenbuche... 169 1e-39
ref|YP_002944166.1| flagellar M-ring protein FliF [Variovorax pa... 169 1e-39
ref|ZP_04682761.1| flagellar M-ring protein FliF [Ochrobactrum i... 169 1e-39
gb|EDC91757.1| hypothetical protein GOS_1391772 [marine metagenome] 169 1e-39
ref|YP_001738763.1| flagellar M-ring protein FliF [Thermotoga sp... 169 2e-39
ref|YP_002824812.1| flagellar MS-ring protein [Sinorhizobium fre... 168 2e-39
ref|NP_782275.1| flagellar MS-ring protein [Clostridium tetani E... 168 2e-39
gb|EBG25759.1| hypothetical protein GOS_9463587 [marine metagenome] 168 2e-39
ref|YP_001754359.1| flagellar MS-ring protein [Methylobacterium ... 168 2e-39
gb|EBG12443.1| hypothetical protein GOS_9485876 [marine metagenome] 167 3e-39
gb|EBZ11867.1| hypothetical protein GOS_3150182 [marine metagenome] 167 4e-39
gb|EBT78378.1| hypothetical protein GOS_7216574 [marine metagenome] 167 4e-39
gb|EDH32626.1| hypothetical protein GOS_625906 [marine metagenome] 167 5e-39
ref|YP_989390.1| flagellar MS-ring protein [Bartonella bacillifo... 167 6e-39
ref|ZP_05881239.1| flagellar M-ring protein FliF [Vibrio metschn... 167 6e-39
ref|ZP_05092240.1| flagellar M-ring protein FliF [Carboxydibrach... 167 6e-39
ref|ZP_01226282.1| putative flagellar M-ring protein [Aurantimon... 167 6e-39
ref|YP_001523543.1| flagellar MS-ring protein [Azorhizobium caul... 167 6e-39
ref|YP_001471516.1| flagellar M-ring protein FliF [Thermotoga le... 167 7e-39
ref|YP_877975.1| flagellar MS-ring protein [Clostridium novyi NT... 167 7e-39
ref|YP_004277776.1| flagellar MS-ring protein [Agrobacterium sp.... 166 7e-39
ref|NP_623060.1| flagellar biosynthesis/type III secretory pathw... 166 8e-39
ref|YP_002279830.1| flagellar MS-ring protein [Rhizobium legumin... 166 1e-38
ref|ZP_08271387.1| Flagellar M-ring protein fliF [gamma proteoba... 166 1e-38
gb|EBK25651.1| hypothetical protein GOS_8762551 [marine metagenome] 166 1e-38
ref|ZP_04822046.1| flagellar M-ring protein FliF [Clostridium bo... 165 2e-38
ref|YP_002489041.1| flagellar M-ring protein FliF [Arthrobacter ... 165 2e-38
ref|YP_001490855.1| flagellar M-ring protein FliF [Arcobacter bu... 165 2e-38
ref|ZP_04581616.1| flagellar M-ring protein [Helicobacter bilis ... 165 2e-38
ref|YP_002974187.1| flagellar MS-ring protein [Rhizobium legumin... 165 2e-38
gb|ECA96588.1| hypothetical protein GOS_6257142 [marine metagenome] 165 2e-38
gb|AAC01568.1| M-ring [Brucella abortus] 165 2e-38
gb|ECN04224.1| hypothetical protein GOS_4007540 [marine metagenome] 165 2e-38
ref|NP_384752.1| flagellar MS-ring protein [Sinorhizobium melilo... 165 2e-38
ref|YP_766305.1| flagellar MS-ring protein [Rhizobium leguminosa... 165 2e-38
ref|YP_003579613.1| flagellar M-ring protein FliF [Rhodobacter c... 164 3e-38
gb|ECF38826.1| hypothetical protein GOS_6450901 [marine metagenome] 164 3e-38
ref|YP_001920202.1| flagellar MS-ring protein [Clostridium botul... 164 5e-38
ref|YP_001305728.1| flagellar M-ring protein FliF [Thermosipho m... 164 5e-38
gb|EBP23135.1| hypothetical protein GOS_7944677 [marine metagenome] 164 6e-38
ref|ZP_05111803.1| truncated flagellar M-ring protein FliF [Legi... 164 6e-38
ref|ZP_01438710.1| flagellar M-ring protein [Fulvimarina pelagi ... 163 6e-38
ref|YP_001325936.1| flagellar MS-ring protein [Sinorhizobium med... 163 7e-38
emb|CBI80624.1| Flagellar M-ring protein [Bartonella sp. 1-1C] 163 7e-38
gb|ECA49032.1| hypothetical protein GOS_4643636 [marine metagenome] 163 7e-38
ref|YP_004305606.1| flagellar M-ring protein [polymorphum gilvum... 163 9e-38
ref|ZP_02165087.1| flagellar M-ring protein [Hoeflea phototrophi... 163 9e-38
gb|EBE51089.1| hypothetical protein GOS_9751526 [marine metagenome] 162 1e-37
gb|EDH89442.1| hypothetical protein GOS_523236 [marine metagenome] 162 1e-37
gb|EBJ35045.1| hypothetical protein GOS_8912919 [marine metagenome] 162 1e-37
emb|CBI79033.1| Flagellar M-ring protein FliF [Bartonella sp. AR... 162 1e-37
ref|ZP_07473980.1| flagellar M-ring protein FliF [Brucella sp. B... 162 1e-37
ref|ZP_07891564.1| flagellar M-ring protein FliF [Arcobacter but... 162 2e-37
ref|YP_001682640.1| flagellar MS-ring protein [Caulobacter sp. K... 162 2e-37
ref|ZP_02622195.1| flagellar M-ring protein FliF [Clostridium bo... 162 2e-37
gb|EBZ29530.1| hypothetical protein GOS_5926932 [marine metagenome] 162 2e-37
gb|EBI55693.1| hypothetical protein GOS_9072662 [marine metagenome] 161 3e-37
gb|EBI74778.1| hypothetical protein GOS_9040333 [marine metagenome] 161 3e-37
ref|YP_061692.1| flagellar M-ring protein [Leifsonia xyli subsp.... 161 3e-37
ref|NP_104152.1| flagellar MS-ring protein [Mesorhizobium loti M... 161 3e-37
ref|YP_004610575.1| flagellar M-ring protein FliF [Mesorhizobium... 161 3e-37
gb|AEH77565.1| flagellar MS-ring protein [Sinorhizobium meliloti... 161 4e-37
ref|YP_003108779.1| flagellar M-ring protein FliF [Acidimicrobiu... 161 4e-37
gb|EDH30542.1| hypothetical protein GOS_629582 [marine metagenome] 160 4e-37
gb|ECM52418.1| hypothetical protein GOS_6083815 [marine metagenome] 160 5e-37
ref|YP_002759843.1| flagellar M-ring protein [Gemmatimonas auran... 160 5e-37
emb|CAA11947.1| flagellar basal-body MS-ring protein [Sinorhizob... 160 6e-37
ref|ZP_05390670.1| flagellar M-ring protein FliF [Clostridium ca... 160 7e-37
ref|YP_004062349.1| flagellar MS-ring protein [Candidatus Liberi... 160 7e-37
gb|EBT53671.1| hypothetical protein GOS_7257529 [marine metagenome] 160 9e-37
ref|YP_001833750.1| flagellar MS-ring protein [Beijerinckia indi... 159 1e-36
ref|ZP_01156099.1| putative flagellar M-ring protein [Oceanicola... 159 1e-36
ref|YP_002550953.1| flagellar MS-ring protein [Agrobacterium vit... 159 2e-36
ref|YP_001923321.1| flagellar MS-ring protein [Methylobacterium ... 158 2e-36
ref|YP_001044846.1| flagellar MS-ring protein [Rhodobacter sphae... 158 2e-36
ref|ZP_00952910.1| flagellar M-ring protein [Oceanicaulis alexan... 158 2e-36
ref|YP_001394543.1| flagellar MS-ring protein [Clostridium kluyv... 158 2e-36
gb|ECT56241.1| hypothetical protein GOS_5475119 [marine metagenome] 158 2e-36
emb|CBI77559.1| Flagellar M-ring protein [Bartonella rochalimae ... 158 2e-36
ref|YP_003477061.1| flagellar M-ring protein FliF [Thermoanaerob... 158 3e-36
ref|YP_003677012.1| flagellar M-ring protein FliF [Thermoanaerob... 157 4e-36
gb|EBC22604.1| hypothetical protein GOS_104421 [marine metagenome] 157 5e-36
ref|YP_004141148.1| flagellar M-ring protein FliF [Mesorhizobium... 157 5e-36
gb|EDI22864.1| hypothetical protein GOS_467210 [marine metagenome] 157 5e-36
gb|EBK84876.1| hypothetical protein GOS_8665173 [marine metagenome] 157 6e-36
ref|ZP_07453761.1| flagellar M-ring protein FliF [Eubacterium yu... 157 7e-36
ref|NP_773504.1| flagellar MS-ring protein [Bradyrhizobium japon... 157 7e-36
ref|YP_002527073.1| flagellar MS-ring protein [Rhodobacter sphae... 157 7e-36
ref|YP_004471037.1| flagellar M-ring protein FliF [Thermoanaerob... 156 8e-36
ref|YP_004599547.1| flagellar M-ring protein FliF [Cellvibrio gi... 156 9e-36
gb|EBM25035.1| hypothetical protein GOS_8439329 [marine metagenome] 156 1e-35
ref|YP_003065108.1| flagellar MS-ring protein [Candidatus Liberi... 156 1e-35
gb|ECA93674.1| hypothetical protein GOS_6376816 [marine metagenome] 156 1e-35
ref|ZP_02151690.1| flagellar M-ring protein FliF [Oceanibulbus i... 155 2e-35
gb|EBZ88873.1| hypothetical protein GOS_3561768 [marine metagenome] 155 2e-35
ref|YP_003391849.1| flagellar M-ring protein FliF [Conexibacter ... 155 2e-35
ref|YP_003066311.1| flagellar M-ring protein FliF [Methylobacter... 154 3e-35
gb|ECQ53886.1| hypothetical protein GOS_5254219 [marine metagenome] 154 3e-35
gb|EBM04931.1| hypothetical protein GOS_8471489 [marine metagenome] 154 3e-35
ref|YP_004395806.1| flagellar M-ring protein FliF [Clostridium b... 154 3e-35
gb|EDI03591.1| hypothetical protein GOS_499857 [marine metagenome] 154 4e-35
ref|ZP_08414111.1| FliF2 [Rhodobacter sphaeroides WS8N] >gb|EGJ2... 154 4e-35
ref|YP_002419490.1| flagellar MS-ring protein [Methylobacterium ... 154 5e-35
ref|YP_001638114.1| flagellar MS-ring protein [Methylobacterium ... 154 5e-35
ref|YP_001311334.1| flagellar MS-ring protein [Clostridium beije... 154 5e-35
ref|YP_002961674.1| flagellar M-ring protein FliF [methylobacter... 154 5e-35
gb|EDC73895.1| hypothetical protein GOS_1423050 [marine metagenome] 154 6e-35
gb|EBP79120.1| hypothetical protein GOS_7854059 [marine metagenome] 153 8e-35
ref|NP_353552.1| flagellar MS-ring protein [Agrobacterium tumefa... 153 9e-35
ref|ZP_08528626.1| flagellar MS-ring protein [Agrobacterium sp. ... 152 1e-34
ref|YP_916432.1| flagellar MS-ring protein [Paracoccus denitrifi... 152 1e-34
ref|YP_001168937.1| flagellar MS-ring protein [Rhodobacter sphae... 152 1e-34
gb|ECH31500.1| hypothetical protein GOS_5755415 [marine metagenome] 152 1e-34
ref|YP_354394.3| flagellar MS-ring protein [Rhodobacter sphaeroi... 152 1e-34
gb|EBD94148.1| hypothetical protein GOS_9847170 [marine metagenome] 152 1e-34
ref|ZP_05117118.1| flagellar M-ring protein FliF [Labrenzia alex... 152 2e-34
gb|EBG25587.1| hypothetical protein GOS_9463940 [marine metagenome] 152 2e-34
gb|ECU68795.1| hypothetical protein GOS_3384245 [marine metagenome] 152 2e-34
gb|EBV20775.1| hypothetical protein GOS_6940242 [marine metagenome] 152 2e-34
gb|EBP19684.1| hypothetical protein GOS_7950652 [marine metagenome] 151 3e-34
ref|ZP_01547377.1| flagellar M-ring protein [Stappia aggregata I... 150 4e-34
gb|EBN84908.1| hypothetical protein GOS_8178151 [marine metagenome] 150 5e-34
gb|EBZ64732.1| hypothetical protein GOS_4487957 [marine metagenome] 150 5e-34
gb|ECO77836.1| hypothetical protein GOS_4103141 [marine metagenome] 150 5e-34
gb|EBU33265.1| hypothetical protein GOS_7130587 [marine metagenome] 150 5e-34
gb|EBL30694.1| hypothetical protein GOS_8592932 [marine metagenome] 150 6e-34
ref|YP_003757209.1| flagellar M-ring protein FliF [Hyphomicrobiu... 150 6e-34
gb|ECJ82121.1| hypothetical protein GOS_6321725 [marine metagenome] 150 6e-34
ref|YP_002246683.1| flagellar M-ring protein FliF [Coprothermoba... 150 6e-34
ref|ZP_05783367.1| flagellar M-ring protein FliF [Citreicella sp... 150 7e-34
gb|ECQ48896.1| hypothetical protein GOS_5454022 [marine metagenome] 150 8e-34
ref|YP_004012885.1| flagellar M-ring protein FliF [Rhodomicrobiu... 150 8e-34
ref|YP_672855.1| flagellar MS-ring protein [Mesorhizobium sp. BN... 149 1e-33
gb|ECO30945.1| hypothetical protein GOS_5982396 [marine metagenome] 149 1e-33
gb|EBQ12938.1| hypothetical protein GOS_7798608 [marine metagenome] 149 1e-33
gb|ECD83941.1| hypothetical protein GOS_5326804 [marine metagenome] 149 1e-33
gb|EDH37463.1| hypothetical protein GOS_617302 [marine metagenome] 149 2e-33
gb|ECL11688.1| hypothetical protein GOS_4653882 [marine metagenome] 149 2e-33
gb|ECQ37670.1| hypothetical protein GOS_5899892 [marine metagenome] 148 2e-33
gb|ECC46606.1| hypothetical protein GOS_3800470 [marine metagenome] 148 2e-33
ref|ZP_04433451.1| flagellar M-ring protein FliF [Bacillus coagu... 148 3e-33
gb|ECD52026.1| hypothetical protein GOS_3137821 [marine metagenome] 148 3e-33
ref|ZP_06889889.1| flagellar M-ring protein FliF [Methylosinus t... 148 3e-33
ref|ZP_06894564.1| flagellar M-ring protein FliF [Roseomonas cer... 148 3e-33
ref|ZP_01880082.1| flagellar M-ring protein FliF [Roseovarius sp... 148 3e-33
ref|ZP_05131478.1| flagellar MS-ring protein [Clostridium sp. 7_... 148 3e-33
ref|XP_002339855.1| predicted protein [Populus trichocarpa] >gb|... 147 4e-33
gb|EBG39991.1| hypothetical protein GOS_9439530 [marine metagenome] 147 4e-33
ref|YP_003852053.1| flagellar M-ring protein FliF [Thermoanaerob... 147 4e-33
ref|YP_002543379.1| flagellar M-ring protein [Agrobacterium radi... 147 4e-33
gb|EBY80349.1| hypothetical protein GOS_4370221 [marine metagenome] 147 5e-33
ref|XP_002536098.1| Flagellar M-ring protein, putative [Ricinus ... 147 5e-33
ref|ZP_04863387.1| flagellar M-ring protein FliF [Clostridium bo... 147 6e-33
ref|YP_003589351.1| flagellar M-ring protein FliF [Bacillus tusc... 147 7e-33
ref|YP_003936766.1| flagellar m-ring protein flif [Clostridium s... 147 7e-33
gb|EDJ25106.1| hypothetical protein GOS_1728727 [marine metagenome] 146 9e-33
ref|YP_003854770.1| flagellar M-ring protein FliF [Parvularcula ... 146 1e-32
ref|ZP_08074709.1| flagellar M-ring protein FliF [Methylocystis ... 146 1e-32
ref|YP_079014.1| flagellar MS-ring protein [Bacillus licheniform... 146 1e-32
gb|ECQ59618.1| hypothetical protein GOS_5029000 [marine metagenome] 146 1e-32
gb|ECN49863.1| hypothetical protein GOS_5684538 [marine metagenome] 146 1e-32
gb|ECE98619.1| hypothetical protein GOS_4495418 [marine metagenome] 145 1e-32
gb|EBY42725.1| hypothetical protein GOS_5891912 [marine metagenome] 145 2e-32
gb|EDH35417.1| hypothetical protein GOS_621022 [marine metagenome] 145 2e-32
gb|EDE53244.1| hypothetical protein GOS_1114476 [marine metagenome] 145 2e-32
ref|ZP_07636955.1| flagellar M-ring protein FliF [Mobiluncus mul... 145 2e-32
gb|ECG98035.1| hypothetical protein GOS_3598681 [marine metagenome] 145 3e-32
gb|ECQ06670.1| hypothetical protein GOS_3612396 [marine metagenome] 144 3e-32
ref|YP_001534598.1| flagellar MS-ring protein [Dinoroseobacter s... 144 3e-32
ref|ZP_07374438.1| flagellar M-ring protein FliF [Ahrensia sp. R... 144 3e-32
gb|EBF10902.1| hypothetical protein GOS_9651391 [marine metagenome] 144 5e-32
ref|ZP_08056210.1| flagellar MS-ring protein-like protein [Paeni... 144 5e-32
gb|ECF38366.1| hypothetical protein GOS_6470007 [marine metagenome] 144 6e-32
gb|EBU32942.1| hypothetical protein GOS_7131067 [marine metagenome] 143 7e-32
ref|ZP_02330411.1| flagellar MS-ring protein [Paenibacillus larv... 143 7e-32
ref|ZP_05086722.1| flagellar M-ring protein FliF [Pseudovibrio s... 143 9e-32
ref|ZP_01157139.1| putative flagellar M-ring protein [Oceanicola... 143 1e-31
ref|ZP_05270384.1| flagellar MS-ring protein [Clostridium diffic... 143 1e-31
gb|ECN88589.1| hypothetical protein GOS_4159779 [marine metagenome] 143 1e-31
ref|YP_530988.1| flagellar MS-ring protein [Rhodopseudomonas pal... 143 1e-31
gb|ECU06096.1| hypothetical protein GOS_3496606 [marine metagenome] 142 1e-31
gb|ECF54985.1| hypothetical protein GOS_5806177 [marine metagenome] 142 1e-31
ref|NP_389503.1| flagellar MS-ring protein [Bacillus subtilis su... 142 1e-31
gb|ECQ05909.1| hypothetical protein GOS_3642340 [marine metagenome] 142 2e-31
ref|ZP_02184088.1| flagellar M-ring protein fliF [Carnobacterium... 142 2e-31
ref|YP_165469.1| flagellar MS-ring protein [Ruegeria pomeroyi DS... 142 2e-31
ref|ZP_03529001.1| flagellar MS-ring protein [Rhizobium etli CIA... 142 2e-31
ref|ZP_05328392.1| flagellar MS-ring protein [Clostridium diffic... 141 3e-31
ref|ZP_01749867.1| flagellar M-ring protein FliF, putative [Rose... 141 3e-31
ref|ZP_06098559.1| flagellar M-ring protein FliF [Brucella sp. 8... 141 3e-31
gb|ECS05850.1| hypothetical protein GOS_6221326 [marine metagenome] 141 3e-31
gb|ECM14467.1| hypothetical protein GOS_4068527 [marine metagenome] 141 3e-31
ref|ZP_05349444.1| flagellar MS-ring protein [Clostridium diffic... 141 3e-31
ref|YP_001086716.1| flagellar MS-ring protein [Clostridium diffi... 141 4e-31
ref|YP_004207674.1| flagellar MS-ring protein [Bacillus subtilis... 141 4e-31
ref|ZP_03591343.1| flagellar MS-ring protein [Bacillus subtilis ... 141 4e-31
gb|EBB56747.1| hypothetical protein GOS_211647 [marine metagenome] 140 4e-31
gb|ECC26787.1| hypothetical protein GOS_4560288 [marine metagenome] 140 5e-31
ref|ZP_01116018.1| flagellar M-ring protein FliF [Reinekea sp. M... 140 5e-31
ref|ZP_05650942.1| flagellar M-ring protein fliF [Enterococcus g... 140 6e-31
gb|EBS26517.1| hypothetical protein GOS_7464923 [marine metagenome] 140 6e-31
gb|ECP29758.1| hypothetical protein GOS_5535509 [marine metagenome] 140 7e-31
ref|ZP_06499878.1| flagellar MS-ring protein [Pseudomonas syring... 140 7e-31
ref|YP_004568576.1| flagellar M-ring protein FliF [Bacillus coag... 140 7e-31
gb|EBB46189.1| hypothetical protein GOS_229633 [marine metagenome] 140 8e-31
ref|YP_314846.1| flagellar biosynthesis/type III secretory pathw... 140 8e-31
ref|ZP_06183262.1| flagellar M-ring protein FliF [Mobiluncus mul... 140 8e-31
ref|ZP_03994848.1| flagellar M-ring protein FliF [Mobiluncus mul... 139 9e-31
ref|YP_002360380.1| flagellar MS-ring protein [Methylocella silv... 139 1e-30
gb|ECX39322.1| hypothetical protein GOS_2546398 [marine metagenome] 139 1e-30
gb|EBZ70749.1| hypothetical protein GOS_4266687 [marine metagenome] 139 1e-30
ref|ZP_05655644.1| flagellar M-ring protein fliF [Enterococcus c... 139 1e-30
ref|ZP_05646031.1| flagellar M-ring protein fliF [Enterococcus c... 139 2e-30
ref|YP_001421198.1| flagellar MS-ring protein [Bacillus amyloliq... 139 2e-30
gb|EBP81510.1| hypothetical protein GOS_7850178 [marine metagenome] 139 2e-30
ref|YP_680680.1| flagellar MS-ring protein [Roseobacter denitrif... 139 2e-30
gb|EGJ00503.1| flagellar M-ring protein domain protein [Shigella... 139 2e-30
gb|EBD45785.1| hypothetical protein GOS_9926642 [marine metagenome] 139 2e-30
gb|EBR09401.1| hypothetical protein GOS_7653438 [marine metagenome] 139 2e-30
ref|ZP_07910399.1| flagellar M-ring protein [Mobiluncus curtisii... 139 2e-30
gb|ECU57413.1| hypothetical protein GOS_3826134 [marine metagenome] 138 2e-30
gb|EDF51734.1| hypothetical protein GOS_941457 [marine metagenome] 138 2e-30
ref|YP_003718677.1| flagellar M-ring protein FliF [Mobiluncus cu... 138 2e-30
ref|ZP_05343442.1| flagellar M-ring protein FliF [Thalassiobium ... 138 3e-30
ref|ZP_07907483.1| flagellar M-ring protein [Mobiluncus curtisii... 138 3e-30
gb|ECF84834.1| hypothetical protein GOS_4599478 [marine metagenome] 138 3e-30
ref|YP_780098.1| flagellar MS-ring protein [Rhodopseudomonas pal... 137 4e-30
ref|ZP_00209445.1| COG1766: Flagellar biosynthesis/type III secr... 137 4e-30
ref|ZP_06715199.1| flagellar M-ring protein [Edwardsiella tarda ... 137 4e-30
ref|ZP_01745848.1| flagellar M-ring protein FliF [Sagittula stel... 137 5e-30
ref|ZP_08081630.1| putative flagellar M-ring protein fliF [Lacto... 137 5e-30
ref|ZP_02139932.1| flagellar M-ring protein FliF, putative [Rose... 137 6e-30
ref|ZP_08563344.1| flagellar M-ring protein fliF [Lactobacillus ... 137 6e-30
gb|EBW68970.1| hypothetical protein GOS_6707032 [marine metagenome] 137 7e-30
gb|EBC11092.1| hypothetical protein GOS_122494 [marine metagenome] 137 7e-30
ref|ZP_05953139.1| flagellar MS-ring protein [Brucella pinnipedi... 136 1e-29
ref|YP_003920288.1| flagellar basal-body M-ring protein [Bacillu... 136 1e-29
gb|EBZ97765.1| hypothetical protein GOS_3218257 [marine metagenome] 136 1e-29
ref|ZP_05930865.1| flagellar M-ring protein FliF [Brucella ceti ... 136 1e-29
ref|ZP_04511447.1| Flagellar M-ring protein fliF [Yersinia pesti... 136 1e-29
ref|ZP_05168316.1| flagellar MS-ring protein [Brucella pinnipedi... 136 1e-29
gb|EBF53644.1| hypothetical protein GOS_9581591 [marine metagenome] 136 1e-29
gb|ECJ04141.1| hypothetical protein GOS_5895324 [marine metagenome] 135 2e-29
gb|EBN43881.1| hypothetical protein GOS_8246627 [marine metagenome] 135 2e-29
gb|EBB16671.1| hypothetical protein GOS_278665 [marine metagenome] 135 2e-29
ref|ZP_06873310.1| flagellar MS-ring protein [Bacillus subtilis ... 135 2e-29
ref|ZP_08144198.1| flagellar M-ring protein fliF [Enterococcus c... 135 3e-29
ref|YP_003973065.1| flagellar MS-ring protein [Bacillus atrophae... 135 3e-29
ref|YP_003964809.1| flagellar M-ring protein FliF, [Ketogulonici... 134 3e-29
gb|ECR32601.1| hypothetical protein GOS_5632917 [marine metagenome] 134 3e-29
ref|ZP_05122077.1| flagellar M-ring protein FliF [Rhodobacterace... 134 4e-29
ref|YP_512122.1| flagellar MS-ring protein [Jannaschia sp. CCS1]... 134 5e-29
ref|YP_001125193.1| flagellar MS-ring protein [Geobacillus therm... 134 6e-29
gb|AEB23977.1| flagellar MS-ring protein [Bacillus amyloliquefac... 134 6e-29
gb|EBZ23617.1| hypothetical protein GOS_6165048 [marine metagenome] 134 7e-29
ref|YP_758973.1| flagellar MS-ring protein [Hyphomonas neptunium... 133 7e-29
gb|EBM93424.1| hypothetical protein GOS_8328830 [marine metagenome] 133 8e-29
gb|ECQ15595.1| hypothetical protein GOS_3278583 [marine metagenome] 133 8e-29
ref|ZP_05741441.1| flagellar MS-ring protein [Silicibacter sp. T... 133 9e-29
ref|ZP_08510159.1| flagellar M-ring protein FliF [Paenibacillus ... 133 1e-28
gb|AEB63320.1| flagellar basal-body M-ring protein [Bacillus amy... 132 1e-28
ref|ZP_03146341.1| flagellar M-ring protein FliF [Geobacillus sp... 132 1e-28
gb|ECD95355.1| hypothetical protein GOS_4871049 [marine metagenome] 132 1e-28
gb|EBY88917.1| hypothetical protein GOS_4042823 [marine metagenome] 132 2e-28
ref|YP_002316087.1| flagellar MS-ring protein [Anoxybacillus fla... 132 2e-28
gb|ECB83946.1| hypothetical protein GOS_6288348 [marine metagenome] 132 2e-28
gb|EBG14855.1| hypothetical protein GOS_9481908 [marine metagenome] 132 2e-28
gb|ECG54834.1| hypothetical protein GOS_5303973 [marine metagenome] 132 2e-28
gb|ECH09119.1| hypothetical protein GOS_3173487 [marine metagenome] 132 2e-28
ref|YP_003989995.1| flagellar M-ring protein FliF [Geobacillus s... 132 2e-28
ref|YP_004375670.1| flagellar M-ring protein [Carnobacterium sp.... 132 2e-28
ref|ZP_08533358.1| flagellar M-ring protein FliF [Caldalkalibaci... 131 3e-28
gb|ECU72068.1| hypothetical protein GOS_3263075 [marine metagenome] 131 3e-28
gb|EBN60753.1| hypothetical protein GOS_8218352 [marine metagenome] 131 3e-28
ref|ZP_01754269.1| flagellar M-ring protein FliF [Roseobacter sp... 131 3e-28
gb|ECM60635.1| hypothetical protein GOS_5753544 [marine metagenome] 131 4e-28
ref|ZP_01443283.1| flagellar M-ring protein FliF [Pelagibaca ber... 131 4e-28
gb|ECN96195.1| hypothetical protein GOS_3871099 [marine metagenome] 131 4e-28
ref|YP_001486762.1| flagellar MS-ring protein [Bacillus pumilus ... 130 5e-28
ref|YP_001513019.1| flagellar M-ring protein FliF [Alkaliphilus ... 130 6e-28
gb|EDH88932.1| hypothetical protein GOS_524108 [marine metagenome] 130 8e-28
ref|ZP_08003723.1| flagellar M-ring protein [Bacillus sp. 2_A_57... 130 8e-28
gb|EBH93637.1| hypothetical protein GOS_9176951 [marine metagenome] 130 8e-28
ref|YP_002949237.1| flagellar MS-ring protein [Geobacillus sp. W... 129 1e-27
gb|EBF44695.1| hypothetical protein GOS_9596190 [marine metagenome] 129 1e-27
gb|ECT70935.1| hypothetical protein GOS_4879731 [marine metagenome] 129 1e-27
gb|EBW13192.1| hypothetical protein GOS_6795485 [marine metagenome] 129 1e-27
gb|EBO46447.1| hypothetical protein GOS_8075968 [marine metagenome] 129 1e-27
gb|EBQ93922.1| hypothetical protein GOS_7674966 [marine metagenome] 128 2e-27
gb|ECN62191.1| hypothetical protein GOS_5181132 [marine metagenome] 128 3e-27
ref|ZP_07708220.1| flagellar MS-ring protein [Bacillus sp. m3-13] 128 3e-27
gb|ECT28347.1| hypothetical protein GOS_7062848 [marine metagenome] 128 3e-27
gb|EBF18634.1| hypothetical protein GOS_9638896 [marine metagenome] 128 3e-27
gb|EBE96663.1| hypothetical protein GOS_9674935 [marine metagenome] 128 3e-27
gb|ECM73899.1| hypothetical protein GOS_5216970 [marine metagenome] 127 4e-27
ref|YP_003671881.1| flagellar M-ring protein FliF [Geobacillus s... 127 5e-27
ref|YP_147072.1| flagellar MS-ring protein [Geobacillus kaustoph... 127 5e-27
ref|ZP_03052975.1| flagellar M-ring protein FliF [Bacillus pumil... 127 6e-27
ref|YP_003253101.1| flagellar MS-ring protein [Geobacillus sp. Y... 127 6e-27
ref|ZP_06499879.1| flagellar MS-ring protein [Pseudomonas syring... 127 6e-27
ref|YP_003564639.1| flagellar M-ring protein FliF [Bacillus mega... 127 7e-27
ref|ZP_05100330.1| flagellar M-ring protein FliF, putative [Rose... 126 9e-27
gb|ECV93646.1| hypothetical protein GOS_2809098 [marine metagenome] 126 9e-27
ref|ZP_02145462.1| flagellar M-ring protein FliF [Phaeobacter ga... 126 1e-26
ref|ZP_02149944.1| flagellar M-ring protein FliF [Phaeobacter ga... 125 1e-26
gb|ECC00617.1| hypothetical protein GOS_5605302 [marine metagenome] 125 2e-26
ref|ZP_01171526.1| flagellar M-ring protein [Bacillus sp. NRRL B... 125 2e-26
gb|ECE13445.1| hypothetical protein GOS_4163720 [marine metagenome] 125 2e-26
gb|EBO62710.1| hypothetical protein GOS_8048524 [marine metagenome] 125 2e-26
ref|YP_003599360.1| flagellar M-ring protein FliF [Bacillus mega... 125 2e-26
gb|EDA94497.1| hypothetical protein GOS_1908481 [marine metagenome] 125 3e-26
ref|NP_692476.1| flagellar MS-ring protein [Oceanobacillus iheye... 125 3e-26
ref|YP_004644214.1| flagellar MS-ring protein [Paenibacillus muc... 125 3e-26
ref|YP_003946301.1| flagellar m-ring protein flif [Paenibacillus... 124 3e-26
gb|ECC14419.1| hypothetical protein GOS_5040136 [marine metagenome] 124 4e-26
ref|ZP_01625747.1| flagellar M-ring protein [marine gamma proteo... 124 5e-26
gb|EDB72335.1| hypothetical protein GOS_1604831 [marine metagenome] 124 6e-26
ref|YP_003870257.1| flagellar M-ring protein FliF [Paenibacillus... 123 7e-26
gb|EDC92938.1| hypothetical protein GOS_1389780 [marine metagenome] 123 9e-26
ref|YP_001838147.1| flagellar MS-ring protein [Leptospira biflex... 123 1e-25
ref|ZP_05786108.1| flagellar M-ring protein FliF [Silicibacter l... 123 1e-25
ref|ZP_03226176.1| flagellar MS-ring protein [Bacillus coahuilen... 123 1e-25
ref|NP_243324.1| flagellar MS-ring protein [Bacillus halodurans ... 123 1e-25
gb|EBV18703.1| hypothetical protein GOS_6943062 [marine metagenome] 122 1e-25
ref|NP_712772.1| flagellar MS-ring protein [Leptospira interroga... 122 2e-25
gb|ECM31743.1| hypothetical protein GOS_3396118 [marine metagenome] 122 2e-25
gb|ECB02397.1| hypothetical protein GOS_6008810 [marine metagenome] 122 2e-25
ref|YP_004462872.1| flagellar M-ring protein FliF [Mahella austr... 122 2e-25
gb|ECF68975.1| hypothetical protein GOS_5228094 [marine metagenome] 122 2e-25
gb|ECT45975.1| hypothetical protein GOS_5889632 [marine metagenome] 122 2e-25
ref|ZP_05087919.1| flagellar M-ring protein FliF [Ruegeria sp. R... 122 3e-25
gb|EBP28772.1| hypothetical protein GOS_7935359 [marine metagenome] 121 3e-25
ref|YP_003012176.1| flagellar MS-ring protein [Paenibacillus sp.... 121 4e-25
dbj|BAE19822.1| flagellar M-ring protein [Edwardsiella tarda] 121 4e-25
ref|YP_003244225.1| flagellar MS-ring protein [Paenibacillus sp.... 120 5e-25
ref|YP_175765.1| flagellar MS-ring protein [Bacillus clausii KSM... 120 6e-25
ref|ZP_05079890.1| flagellar M-ring protein FliF [Rhodobacterale... 120 7e-25
gb|EBK16059.1| hypothetical protein GOS_8778498 [marine metagenome] 120 8e-25
ref|YP_004095491.1| flagellar M-ring protein FliF [Bacillus cell... 119 1e-24
ref|ZP_05842391.1| flagellar M-ring protein FliF [Rhodobacter sp... 119 1e-24
gb|EBP61990.1| hypothetical protein GOS_7882074 [marine metagenome] 119 2e-24
ref|ZP_01116017.1| flagellar M-ring protein FliF [Reinekea sp. M... 119 2e-24
gb|ADZ68375.1| flagellar MS-ring protein [Brucella melitensis M28] 119 2e-24
ref|NP_541128.1| flagellar M-ring protein FLIF [Brucella meliten... 119 2e-24
ref|YP_797561.1| flagellar MS-ring protein [Leptospira borgpeter... 119 2e-24
gb|ECJ51788.1| hypothetical protein GOS_4019345 [marine metagenome] 118 2e-24
gb|ECM62871.1| hypothetical protein GOS_5662885 [marine metagenome] 118 2e-24
ref|ZP_05445820.1| flagellar M-ring protein FLIF [Brucella melit... 118 2e-24
ref|YP_614941.1| flagellar MS-ring protein [Ruegeria sp. TM1040]... 118 3e-24
gb|EBR26586.1| hypothetical protein GOS_7627348 [marine metagenome] 118 3e-24
gb|EDB24470.1| hypothetical protein GOS_1857657 [marine metagenome] 118 3e-24
gb|EBM74768.1| hypothetical protein GOS_8359700 [marine metagenome] 118 3e-24
gb|EBN88941.1| hypothetical protein GOS_8171405 [marine metagenome] 118 3e-24
ref|YP_003874130.1| flagellar M-ring protein [Spirochaeta thermo... 117 4e-24
gb|ECM89428.1| hypothetical protein GOS_4587649 [marine metagenome] 117 4e-24
ref|ZP_01000699.1| flagellar FliF M-ring protein [Oceanicola bat... 117 5e-24
ref|YP_004023181.1| flagellar m-ring protein flif [Caldicellulos... 116 9e-24
ref|YP_002887273.1| flagellar MS-ring protein [Exiguobacterium s... 115 2e-23
ref|ZP_08194482.1| flagellar M-ring protein FliF [Clostridium pa... 115 2e-23
gb|ECB57216.1| hypothetical protein GOS_3847656 [marine metagenome] 115 2e-23
ref|YP_002574021.1| flagellar M-ring protein FliF [Caldicellulos... 115 2e-23
gb|EFU20149.1| flagellar M-ring protein FliF [Spirochaeta thermo... 115 3e-23
ref|YP_003991693.1| flagellar m-ring protein flif [Caldicellulos... 115 3e-23
ref|YP_001355.1| flagellar MS-ring protein [Leptospira interroga... 114 3e-23
gb|EBY62888.1| hypothetical protein GOS_5074587 [marine metagenome] 114 4e-23
gb|EBH22973.1| hypothetical protein GOS_9298544 [marine metagenome] 114 4e-23
ref|YP_004003192.1| flagellar m-ring protein flif [Caldicellulos... 114 6e-23
ref|ZP_07736479.1| flagellar M-ring protein FliF [Caldicellulosi... 114 6e-23
ref|YP_003699815.1| flagellar M-ring protein FliF [Bacillus sele... 114 6e-23
gb|EBL00203.1| hypothetical protein GOS_8639883 [marine metagenome] 114 6e-23
ref|ZP_07546428.1| secretory protein YscJ/FliF family protein [T... 114 6e-23
ref|YP_004025570.1| flagellar m-ring protein flif [Caldicellulos... 113 8e-23
gb|EBU58907.1| hypothetical protein GOS_7037427 [marine metagenome] 113 8e-23
gb|EDG43083.1| hypothetical protein GOS_783217 [marine metagenome] 112 1e-22
gb|EBQ15624.1| hypothetical protein GOS_7794448 [marine metagenome] 112 1e-22
gb|EBB42915.1| hypothetical protein GOS_235057 [marine metagenome] 112 2e-22
gb|EDD22531.1| hypothetical protein GOS_1337477 [marine metagenome] 110 5e-22
gb|ECB09102.1| hypothetical protein GOS_5746473 [marine metagenome] 110 6e-22
gb|EBJ65180.1| hypothetical protein GOS_8862687 [marine metagenome] 110 6e-22
ref|YP_001318494.1| flagellar M-ring protein FliF [Alkaliphilus ... 110 6e-22
ref|ZP_01860976.1| flagellar M-ring protein [Bacillus sp. SG-1] ... 110 7e-22
ref|YP_001320536.1| flagellar M-ring protein FliF [Alkaliphilus ... 109 1e-21
ref|ZP_07385906.1| flagellar M-ring protein FliF [Paenibacillus ... 109 1e-21
gb|EBW29126.1| hypothetical protein GOS_6769710 [marine metagenome] 109 1e-21
ref|YP_002506377.1| flagellar M-ring protein FliF [Clostridium c... 109 1e-21
ref|ZP_03373443.1| flagellar MS-ring protein [Salmonella enteric... 109 1e-21
gb|EBE34059.1| hypothetical protein GOS_9780288 [marine metagenome] 109 2e-21
gb|ECK72604.1| hypothetical protein GOS_6237504 [marine metagenome] 108 2e-21
ref|YP_003425000.1| flagellar MS-ring protein [Bacillus pseudofi... 108 2e-21
gb|EBP70393.1| hypothetical protein GOS_7868163 [marine metagenome] 108 3e-21
ref|YP_001697278.1| flagellar MS-ring protein [Lysinibacillus sp... 108 3e-21
gb|ECS17431.1| hypothetical protein GOS_5755343 [marine metagenome] 108 3e-21
gb|ECD05311.1| hypothetical protein GOS_4968466 [marine metagenome] 108 3e-21
ref|ZP_04288702.1| Flagellar M-ring protein fliF [Bacillus cereu... 108 3e-21
gb|ECO84520.1| hypothetical protein GOS_3845537 [marine metagenome] 108 4e-21
gb|EFS14573.1| flagellar M-ring domain protein [Shigella flexner... 107 4e-21
ref|YP_003841207.1| flagellar M-ring protein FliF [Caldicellulos... 107 5e-21
ref|ZP_07048117.1| flagellar MS-ring protein [Lysinibacillus fus... 107 5e-21
gb|EBL57369.1| hypothetical protein GOS_8549365 [marine metagenome] 107 5e-21
gb|ECN21113.1| hypothetical protein GOS_3339965 [marine metagenome] 107 5e-21
gb|EBD27393.1| hypothetical protein GOS_9955762 [marine metagenome] 107 7e-21
gb|ECS42081.1| hypothetical protein GOS_4777821 [marine metagenome] 107 7e-21
ref|ZP_01725667.1| flagellar M-ring protein [Bacillus sp. B14905... 107 8e-21
gb|ECN33497.1| hypothetical protein GOS_6350062 [marine metagenome] 106 1e-20
ref|YP_001374675.1| flagellar MS-ring protein [Bacillus cereus s... 106 1e-20
gb|ECP35162.1| hypothetical protein GOS_6442309 [marine metagenome] 106 1e-20
gb|EBB06731.1| hypothetical protein GOS_294554 [marine metagenome] 106 1e-20
gb|EBX25844.1| hypothetical protein GOS_6616102 [marine metagenome] 105 2e-20
gb|ECD54655.1| hypothetical protein GOS_3030429 [marine metagenome] 105 2e-20
gb|ECO66874.1| hypothetical protein GOS_4513695 [marine metagenome] 105 3e-20
gb|EDI94731.1| hypothetical protein GOS_1781133 [marine metagenome] 105 3e-20
gb|EBY97966.1| hypothetical protein GOS_3683575 [marine metagenome] 104 3e-20
gb|EBU05894.1| hypothetical protein GOS_7172961 [marine metagenome] 104 5e-20
ref|ZP_03991796.1| flagellar M-ring protein FliF [Oribacterium s... 103 7e-20
ref|YP_001180051.1| flagellar M-ring protein FliF [Caldicellulos... 103 9e-20
ref|ZP_04233053.1| Flagellar M-ring protein fliF [Bacillus cereu... 103 1e-19
ref|ZP_04227205.1| Flagellar M-ring protein fliF [Bacillus cereu... 103 1e-19
gb|ECG10597.1| hypothetical protein GOS_3610684 [marine metagenome] 103 1e-19
gb|ECQ90303.1| hypothetical protein GOS_3818497 [marine metagenome] 103 1e-19
gb|ECG98755.1| hypothetical protein GOS_3568865 [marine metagenome] 102 2e-19
ref|ZP_04196764.1| Flagellar M-ring protein fliF [Bacillus cereu... 102 2e-19
ref|YP_001644436.1| flagellar MS-ring protein [Bacillus weihenst... 102 2e-19
ref|YP_003803283.1| flagellar M-ring protein FliF [Spirochaeta s... 102 2e-19
ref|ZP_04294339.1| Flagellar M-ring protein fliF [Bacillus cereu... 102 2e-19
gb|ECD05312.1| hypothetical protein GOS_4968468 [marine metagenome] 102 2e-19
gb|ECB95797.1| hypothetical protein GOS_5808303 [marine metagenome] 102 2e-19
gb|ECJ09079.1| hypothetical protein GOS_5696875 [marine metagenome] 102 2e-19
gb|ECQ15596.1| hypothetical protein GOS_3278585 [marine metagenome] 102 3e-19
gb|EDI47314.1| hypothetical protein GOS_426811 [marine metagenome] 101 3e-19
gb|EBN91817.1| hypothetical protein GOS_8166758 [marine metagenome] 101 4e-19
gb|ECY62119.1| hypothetical protein GOS_2328052 [marine metagenome] 101 4e-19
gb|ECF60515.1| hypothetical protein GOS_5578759 [marine metagenome] 101 4e-19
gb|ECU18581.1| hypothetical protein GOS_5367858 [marine metagenome] 100 5e-19
gb|ECD40011.1| hypothetical protein GOS_3600238 [marine metagenome] 100 7e-19
gb|ECI24082.1| hypothetical protein GOS_5587494 [marine metagenome] 100 7e-19
gb|EBD42861.1| hypothetical protein GOS_9931363 [marine metagenome] 100 8e-19
ref|ZP_04299952.1| Flagellar M-ring protein fliF [Bacillus cereu... 100 8e-19
gb|ECB37581.1| hypothetical protein GOS_4612255 [marine metagenome] 100 8e-19
ref|YP_003823618.1| flagellar M-ring protein FliF [Clostridium s... 100 9e-19
ref|ZP_04250529.1| Flagellar M-ring protein fliF [Bacillus cereu... 100 9e-19
ref|ZP_04145002.1| Flagellar M-ring protein fliF [Bacillus thuri... 100 9e-19
ref|ZP_04095893.1| Flagellar M-ring protein fliF [Bacillus thuri... 100 1e-18
ref|ZP_07055125.1| flagellar MS-ring protein [Bacillus cereus SJ... 100 1e-18
ref|ZP_04077940.1| Flagellar M-ring protein fliF [Bacillus thuri... 100 1e-18
ref|YP_035866.1| flagellar MS-ring protein [Bacillus thuringiens... 100 1e-18
ref|ZP_04221940.1| Flagellar M-ring protein fliF [Bacillus cereu... 100 1e-18
ref|ZP_04071237.1| Flagellar M-ring protein fliF [Bacillus thuri... 99.8 1e-18
gb|EBF61136.1| hypothetical protein GOS_9569534 [marine metagenome] 99.8 1e-18
gb|ECR37487.1| hypothetical protein GOS_5431873 [marine metagenome] 99.8 1e-18
gb|EBE29170.1| hypothetical protein GOS_9788406 [marine metagenome] 99.8 1e-18
dbj|BAK17420.1| flagellar biosynthesis/type III secretory pathwa... 99.8 1e-18
ref|YP_027827.1| flagellar MS-ring protein [Bacillus anthracis s... 99.8 1e-18
ref|YP_894333.1| flagellar MS-ring protein [Bacillus thuringiens... 99.8 1e-18
ref|NP_978086.1| flagellar MS-ring protein [Bacillus cereus ATCC... 99.4 1e-18
gb|ADY21024.1| flagellar MS-ring protein [Bacillus thuringiensis... 99.4 2e-18
gb|ECJ17727.1| hypothetical protein GOS_5342328 [marine metagenome] 99.4 2e-18
ref|YP_004530523.1| flagellar M-ring protein FliF [Treponema pri... 99.0 2e-18
ref|ZP_03112356.1| putative flagellar M-ring protein FliF [Bacil... 99.0 2e-18
ref|ZP_04101460.1| Flagellar M-ring protein fliF [Bacillus thuri... 98.6 2e-18
ref|ZP_00741134.1| Flagellar M-ring protein fliF [Bacillus thuri... 98.6 2e-18
ref|ZP_04191210.1| Flagellar M-ring protein fliF [Bacillus cereu... 98.6 3e-18
ref|ZP_04173954.1| Flagellar M-ring protein fliF [Bacillus cereu... 98.6 3e-18
ref|NP_831422.1| flagellar MS-ring protein [Bacillus cereus ATCC... 98.6 3e-18
ref|ZP_04202588.1| Flagellar M-ring protein fliF [Bacillus cereu... 98.6 3e-18
ref|ZP_04114221.1| Flagellar M-ring protein fliF [Bacillus thuri... 98.6 3e-18
ref|ZP_07054175.1| flagellar M-ring protein FliF [Listeria grayi... 98.6 3e-18
ref|YP_002529430.1| flagellar ms-ring protein [Bacillus cereus Q... 98.6 3e-18
ref|ZP_03100906.1| putative flagellar M-ring protein FliF [Bacil... 98.2 3e-18
ref|ZP_04316854.1| Flagellar M-ring protein fliF [Bacillus cereu... 98.2 3e-18
ref|ZP_03231666.1| putative flagellar M-ring protein FliF [Bacil... 98.2 3e-18
ref|YP_003664046.1| flagellar MS-ring protein [Bacillus thuringi... 98.2 3e-18
ref|ZP_04278176.1| Flagellar M-ring protein fliF [Bacillus cereu... 98.2 3e-18
gb|ECC65494.1| hypothetical protein GOS_3064256 [marine metagenome] 98.2 3e-18
ref|ZP_04283428.1| Flagellar M-ring protein fliF [Bacillus cereu... 98.2 3e-18
ref|YP_002366431.1| flagellar MS-ring protein [Bacillus cereus B... 98.2 4e-18
ref|ZP_04238802.1| Flagellar M-ring protein fliF [Bacillus cereu... 98.2 4e-18
ref|ZP_04211480.1| Flagellar M-ring protein fliF [Bacillus cereu... 98.2 4e-18
ref|ZP_04119762.1| Flagellar M-ring protein fliF [Bacillus thuri... 98.2 4e-18
ref|ZP_04083802.1| Flagellar M-ring protein fliF [Bacillus thuri... 97.8 4e-18
gb|ECQ90304.1| hypothetical protein GOS_3818498 [marine metagenome] 97.8 5e-18
ref|ZP_03235860.1| putative flagellar M-ring protein FliF [Bacil... 97.8 5e-18
ref|NP_212425.1| flagellar MS-ring protein [Borrelia burgdorferi... 97.4 6e-18
ref|ZP_03539527.1| flagellar M-ring protein FliF [Borrelia garin... 97.4 6e-18
ref|YP_072739.1| flagellar MS-ring protein [Borrelia garinii PBi... 97.4 6e-18
ref|ZP_03540565.1| flagellar M-ring protein FliF [Borrelia garin... 97.1 7e-18
gb|ECO84519.1| hypothetical protein GOS_3845536 [marine metagenome] 97.1 7e-18
gb|EDJ58265.1| hypothetical protein GOS_1670004 [marine metagenome] 97.1 8e-18
ref|ZP_04322712.1| Flagellar M-ring protein fliF [Bacillus cereu... 96.7 9e-18
gb|EBU30185.1| hypothetical protein GOS_7135294 [marine metagenome] 96.7 1e-17
ref|ZP_03773318.1| flagellar M-ring protein FliF [Borrelia sp. S... 96.7 1e-17
ref|YP_002337778.1| flagellar MS-ring protein [Bacillus cereus A... 96.3 1e-17
gb|ECJ66846.1| hypothetical protein GOS_3436433 [marine metagenome] 96.3 1e-17
gb|EGH80932.1| flagellar MS-ring protein [Pseudomonas syringae p... 96.3 1e-17
ref|ZP_04185509.1| Flagellar M-ring protein fliF [Bacillus cereu... 96.3 1e-17
gb|EBJ60517.1| hypothetical protein GOS_8870469 [marine metagenome] 96.3 2e-17
ref|ZP_08095362.1| flagellar MS-ring protein [Planococcus dongha... 95.9 2e-17
gb|EBV97370.1| hypothetical protein GOS_6821281 [marine metagenome] 95.9 2e-17
ref|ZP_03086737.1| flagellar MS-ring protein [Borrelia burgdorfe... 95.9 2e-17
gb|EBL91636.1| hypothetical protein GOS_8493228 [marine metagenome] 95.5 2e-17
gb|ECE47431.1| hypothetical protein GOS_6330001 [marine metagenome] 95.5 2e-17
gb|EBF83577.1| hypothetical protein GOS_9532839 [marine metagenome] 95.1 3e-17
ref|ZP_03492593.1| flagellar M-ring protein FliF [Alicyclobacill... 95.1 3e-17
gb|EBX83614.1| hypothetical protein GOS_6525370 [marine metagenome] 94.7 4e-17
ref|YP_003184805.1| flagellar M-ring protein FliF [Alicyclobacil... 94.7 4e-17
gb|ECG99360.1| hypothetical protein GOS_3545533 [marine metagenome] 94.7 4e-17
gb|EBT42197.1| hypothetical protein GOS_7276352 [marine metagenome] 94.7 4e-17
gb|ECK47795.1| hypothetical protein GOS_3704879 [marine metagenome] 94.7 4e-17
gb|ECW97643.1| hypothetical protein GOS_2621366 [marine metagenome] 94.7 4e-17
ref|ZP_08539048.1| flagellar M-ring protein FliF [Oribacterium s... 94.4 6e-17
gb|EBD94149.1| hypothetical protein GOS_9847172 [marine metagenome] 94.0 7e-17
ref|YP_709734.1| flagellar MS-ring protein [Borrelia afzelii PKo... 93.6 8e-17
ref|YP_004439531.1| flagellar M-ring protein FliF [Treponema bre... 93.6 8e-17
gb|EFU46075.1| hypothetical protein HMPREF9539_03393 [Escherichi... 92.4 2e-16
ref|ZP_04850861.1| flagellar M-ring protein FliF [Paenibacillus ... 92.4 2e-16
gb|ECJ66845.1| hypothetical protein GOS_3436431 [marine metagenome] 92.4 2e-16
ref|ZP_03674969.1| flagellar M-ring protein FliF [Borrelia spiel... 92.0 2e-16
ref|ZP_08615186.1| flagellar M-ring protein FliF [Lachnospiracea... 92.0 2e-16
gb|ECU22778.1| hypothetical protein GOS_5201910 [marine metagenome] 91.7 3e-16
ref|ZP_03672378.1| flagellar M-ring protein FliF [Borrelia valai... 91.7 4e-16
gb|EBP42462.1| hypothetical protein GOS_7913565 [marine metagenome] 91.7 4e-16
gb|ECE04690.1| hypothetical protein GOS_4496345 [marine metagenome] 91.7 4e-16
gb|EBR24405.1| hypothetical protein GOS_7630852 [marine metagenome] 91.3 4e-16
gb|EBC96159.1| hypothetical protein GOS_10007174 [marine metagen... 91.3 4e-16
ref|YP_001883728.1| flagellar MS-ring protein [Borrelia hermsii ... 91.3 5e-16
gb|EGH76063.1| flagellar MS-ring protein [Pseudomonas syringae p... 90.9 5e-16
ref|YP_002221952.1| flagellar M-ring protein [Borrelia duttonii ... 90.9 6e-16
gb|ECN16276.1| hypothetical protein GOS_3530886 [marine metagenome] 90.5 7e-16
gb|EBD54224.1| hypothetical protein GOS_9912480 [marine metagenome] 90.5 7e-16
gb|ECG28680.1| hypothetical protein GOS_6376431 [marine metagenome] 90.5 8e-16
ref|ZP_02422857.1| hypothetical protein EUBSIR_01708 [Eubacteriu... 90.5 8e-16
gb|ECU65591.1| hypothetical protein GOS_3505962 [marine metagenome] 90.1 1e-15
ref|YP_002772964.1| flagellar M-ring protein [Brevibacillus brev... 89.7 1e-15
gb|EDF19171.1| hypothetical protein GOS_998747 [marine metagenome] 89.7 1e-15
ref|YP_561073.1| secretory protein YscJ/FliF [Shewanella denitri... 89.4 2e-15
ref|YP_002222766.1| flagellar M-ring protein [Borrelia recurrent... 89.4 2e-15
ref|YP_003786552.1| flagellar M-ring protein FliF [Brachyspira p... 89.4 2e-15
ref|YP_004526978.1| flagellar M-ring protein FliF [Treponema azo... 89.0 2e-15
ref|ZP_03779004.1| hypothetical protein CLOHYLEM_06074 [Clostrid... 89.0 2e-15
gb|EGD04393.1| flagellar MS-ring protein [Burkholderia sp. TJI49] 89.0 2e-15
gb|EDJ07641.1| hypothetical protein GOS_1759105 [marine metagenome] 88.6 3e-15
gb|AEH40342.1| IIISP family Type III (virulence-related) secreto... 88.6 3e-15
gb|EBG45391.1| hypothetical protein GOS_9430538 [marine metagenome] 88.6 3e-15
ref|YP_004365331.1| flagellar M-ring protein FliF [Treponema suc... 88.6 3e-15
ref|YP_002720867.1| flagellar MS-ring protein [Brachyspira hyody... 88.2 3e-15
emb|CBK97649.1| flagellar basal-body M-ring protein/flagellar ho... 88.2 4e-15
ref|ZP_03509697.1| flagellar MS-ring protein [Rhizobium etli 8C-3] 88.2 4e-15
gb|EBO54563.1| hypothetical protein GOS_8062193 [marine metagenome] 88.2 4e-15
ref|YP_003632666.1| flagellar M-ring protein FliF [Brachyspira m... 88.2 4e-15
gb|EBT27113.1| hypothetical protein GOS_7301183 [marine metagenome] 87.8 5e-15
ref|ZP_08035495.1| flagellar M-ring protein FliF [Treponema phag... 87.8 5e-15
gb|ECT70934.1| hypothetical protein GOS_4879730 [marine metagenome] 87.8 5e-15
gb|ECS21387.1| hypothetical protein GOS_5596221 [marine metagenome] 87.8 5e-15
gb|EDG09675.1| hypothetical protein GOS_841063 [marine metagenome] 87.8 5e-15
ref|ZP_00237167.1| flagellar M-ring protein, putative [Bacillus ... 87.8 5e-15
emb|CBL35316.1| flagellar basal-body M-ring protein/flagellar ho... 87.8 5e-15
ref|NP_218839.1| flagellar MS-ring protein [Treponema pallidum s... 87.4 6e-15
gb|EBC72972.1| hypothetical protein GOS_23297 [marine metagenome] 87.0 9e-15
ref|YP_004092803.1| flagellar M-ring protein FliF [Ethanoligenen... 85.9 2e-14
ref|ZP_08604615.1| flagellar M-ring protein FliF [Lachnospiracea... 85.9 2e-14
gb|AAB57899.1| FliF [Treponema denticola] 85.9 2e-14
ref|YP_002350867.1| flagellar M-ring protein FliF [Listeria mono... 85.9 2e-14
ref|ZP_06556986.1| flagellar M-ring protein FliF [Listeria monoc... 85.9 2e-14
gb|ECS10581.1| hypothetical protein GOS_6029511 [marine metagenome] 85.9 2e-14
ref|YP_001814348.1| flagellar MS-ring protein [Exiguobacterium s... 85.9 2e-14
gb|ECH20477.1| hypothetical protein GOS_6216788 [marine metagenome] 85.5 2e-14
ref|ZP_05275811.1| flagellar MS-ring protein [Listeria monocytog... 85.5 2e-14
ref|YP_002757451.1| flagellar basal-body M-ring protein FliF [Li... 85.5 2e-14
ref|NP_971822.1| flagellar MS-ring protein [Treponema denticola ... 85.5 3e-14
ref|YP_013353.1| flagellar MS-ring protein [Listeria monocytogen... 85.5 3e-14
ref|ZP_00229472.1| flagellar M-ring protein FliF [Listeria monoc... 85.5 3e-14
gb|EGF38358.1| flagellar MS-ring protein [Listeria monocytogenes... 85.5 3e-14
ref|YP_003463863.1| flagellar M-ring protein [Listeria seeligeri... 85.1 3e-14
gb|EFR85433.1| flagellar M-ring protein FliF [Listeria monocytog... 85.1 3e-14
ref|NP_464240.1| flagellar MS-ring protein [Listeria monocytogen... 85.1 3e-14
ref|ZP_05297667.1| flagellar MS-ring protein [Listeria monocytog... 85.1 3e-14
gb|EDH97156.1| hypothetical protein GOS_509937 [marine metagenome] 85.1 3e-14
gb|EFR94654.1| flagellar M-ring protein FliF [Listeria innocua F... 85.1 3e-14
ref|ZP_06491620.1| flagellar MS-ring protein [Xanthomonas campes... 84.7 4e-14
gb|ECR66868.1| hypothetical protein GOS_4261883 [marine metagenome] 84.7 4e-14
ref|YP_945299.1| flagellar MS-ring protein [Borrelia turicatae 9... 84.7 4e-14
ref|ZP_07870015.1| flagellar M-ring protein FliF [Listeria marth... 84.7 4e-14
ref|ZP_05242431.1| flagellar MS-ring protein [Listeria monocytog... 84.3 6e-14
ref|NP_470064.1| flagellar MS-ring protein [Listeria innocua Cli... 84.3 6e-14
gb|ECR85184.1| hypothetical protein GOS_3549194 [marine metagenome] 84.0 6e-14
gb|EBA74710.1| hypothetical protein GOS_349293 [marine metagenome] 84.0 6e-14
gb|EGC76974.1| FliF protein [Treponema denticola F0402] 84.0 7e-14
gb|EFR91558.1| flagellar M-ring protein FliF [Listeria innocua F... 83.6 8e-14
ref|YP_848883.1| flagellar MS-ring protein [Listeria welshimeri ... 83.2 1e-13
gb|EBB36119.1| hypothetical protein GOS_246339 [marine metagenome] 82.4 2e-13
gb|ECN71380.1| hypothetical protein GOS_4812448 [marine metagenome] 82.0 2e-13
gb|EBT68993.1| hypothetical protein GOS_7232148 [marine metagenome] 82.0 3e-13
gb|EBC70827.1| hypothetical protein GOS_26591 [marine metagenome] 81.6 3e-13
gb|EDA82902.1| hypothetical protein GOS_1929819 [marine metagenome] 81.6 3e-13
ref|ZP_08604560.1| flagellar M-ring protein FliF [Lachnospiracea... 81.3 4e-13
gb|ECP77776.1| hypothetical protein GOS_4733624 [marine metagenome] 81.3 5e-13
gb|EDH89819.1| hypothetical protein GOS_522562 [marine metagenome] 81.3 5e-13
ref|ZP_08187774.1| flagellar biosynthesis/type III secretory pat... 80.9 5e-13
ref|ZP_04672023.1| conserved hypothetical protein [Clostridiales... 80.5 8e-13
gb|ECV36802.1| hypothetical protein GOS_2912221 [marine metagenome] 80.5 8e-13
gb|EBF82856.1| hypothetical protein GOS_9533998 [marine metagenome] 80.5 8e-13
ref|YP_004309364.1| flagellar M-ring protein FliF [Clostridium l... 80.5 8e-13
gb|AAA87352.1| flagellar MS-ring protein [Borrelia burgdorferi] 80.1 9e-13
gb|ECR89451.1| hypothetical protein GOS_3377367 [marine metagenome] 80.1 9e-13
gb|ECJ03715.1| hypothetical protein GOS_5913284 [marine metagenome] 80.1 1e-12
gb|ECL47890.1| hypothetical protein GOS_3242460 [marine metagenome] 80.1 1e-12
gb|EDI79582.1| hypothetical protein GOS_373493 [marine metagenome] 80.1 1e-12
gb|EDJ66822.1| hypothetical protein GOS_1654542 [marine metagenome] 79.7 1e-12
ref|ZP_08139766.1| flagellar MS-ring protein [Pseudomonas sp. TJ... 79.3 2e-12
gb|ECZ70540.1| hypothetical protein GOS_2135642 [marine metagenome] 79.3 2e-12
gb|ECB25012.1| hypothetical protein GOS_5114044 [marine metagenome] 79.3 2e-12
ref|ZP_05429758.1| flagellar M-ring protein FliF [Clostridium th... 79.0 2e-12
ref|YP_001036896.1| flagellar M-ring protein FliF [Clostridium t... 79.0 2e-12
gb|EBE10452.1| hypothetical protein GOS_9820165 [marine metagenome] 78.6 3e-12
gb|EBX26768.1| hypothetical protein GOS_6614614 [marine metagenome] 78.6 3e-12
gb|ECC14420.1| hypothetical protein GOS_5040138 [marine metagenome] 78.2 3e-12
ref|ZP_02087014.1| hypothetical protein CLOBOL_04558 [Clostridiu... 77.8 4e-12
ref|ZP_07838496.1| flagellar M-ring protein FliF [Eubacterium ce... 77.4 7e-12
gb|ECJ82120.1| hypothetical protein GOS_6321724 [marine metagenome] 77.0 9e-12
gb|EBQ31238.1| hypothetical protein GOS_7770240 [marine metagenome] 76.3 1e-11
gb|EBU33914.1| hypothetical protein GOS_7129601 [marine metagenome] 76.3 2e-11
gb|EBB47444.1| hypothetical protein GOS_227450 [marine metagenome] 75.9 2e-11
ref|ZP_03245198.1| flagellar MS-ring protein [Helicobacter pylor... 75.9 2e-11
gb|EBT32869.1| hypothetical protein GOS_7291867 [marine metagenome] 75.5 2e-11
gb|ECJ56298.1| hypothetical protein GOS_3846505 [marine metagenome] 75.5 3e-11
gb|EBX41502.1| hypothetical protein GOS_6590946 [marine metagenome] 75.1 3e-11
ref|ZP_07326807.1| flagellar M-ring protein FliF [Acetivibrio ce... 74.3 6e-11
ref|ZP_06116271.1| flagellar M-ring protein FliF [Clostridium ha... 73.9 7e-11
gb|EBP50423.1| hypothetical protein GOS_7900834 [marine metagenome] 73.9 8e-11
gb|ECC21363.1| hypothetical protein GOS_4766746 [marine metagenome] 73.6 8e-11
gb|EBT31986.1| hypothetical protein GOS_7293357 [marine metagenome] 73.6 9e-11
gb|ECF01423.1| hypothetical protein GOS_4384418 [marine metagenome] 73.2 1e-10
gb|ECO02927.1| hypothetical protein GOS_3602674 [marine metagenome] 72.8 2e-10
gb|ECF08915.1| hypothetical protein GOS_4115733 [marine metagenome] 72.8 2e-10
gb|ECF16735.1| hypothetical protein GOS_3808149 [marine metagenome] 72.0 3e-10
gb|EBD22843.1| hypothetical protein GOS_9963676 [marine metagenome] 72.0 3e-10
gb|EBP70361.1| hypothetical protein GOS_7868210 [marine metagenome] 72.0 3e-10
gb|ECN04223.1| hypothetical protein GOS_4007539 [marine metagenome] 70.9 7e-10
ref|YP_002937686.1| flagellar biosynthesis/type III secretory pa... 70.5 7e-10
gb|EGH43724.1| flagellar MS-ring protein [Pseudomonas syringae p... 70.5 9e-10
gb|EDC39252.1| hypothetical protein GOS_1484154 [marine metagenome] 70.1 1e-09
ref|YP_003830678.1| flagellar M-ring protein FliF [Butyrivibrio ... 69.7 1e-09
ref|ZP_05623046.1| flagellar M-ring protein FliF [Treponema vinc... 68.9 2e-09
gb|EBW46843.1| hypothetical protein GOS_6742152 [marine metagenome] 68.9 2e-09
gb|ECL24015.1| hypothetical protein GOS_4167634 [marine metagenome] 68.9 3e-09
gb|EBX17419.1| hypothetical protein GOS_6629095 [marine metagenome] 68.6 3e-09
gb|EBY97967.1| hypothetical protein GOS_3683576 [marine metagenome] 68.2 4e-09
gb|EBV90410.1| hypothetical protein GOS_6832463 [marine metagenome] 68.2 4e-09
ref|ZP_03462464.1| hypothetical protein BACPEC_01529 [Bacteroide... 67.8 5e-09
gb|EBN57233.1| hypothetical protein GOS_8224173 [marine metagenome] 67.8 5e-09
gb|ECA98975.1| hypothetical protein GOS_6153432 [marine metagenome] 67.8 5e-09
gb|AAF35844.1|AF220002_1 flagellar M ring protein FliF [Rhodospi... 67.8 6e-09
gb|ECO01989.1| hypothetical protein GOS_3636150 [marine metagenome] 67.4 7e-09
gb|EBZ64731.1| hypothetical protein GOS_4487956 [marine metagenome] 67.4 7e-09
gb|EBW75806.1| hypothetical protein GOS_6696237 [marine metagenome] 66.6 1e-08
gb|ECB28714.1| hypothetical protein GOS_4971024 [marine metagenome] 66.6 1e-08
ref|ZP_03752538.1| hypothetical protein ROSEINA2194_00942 [Roseb... 66.6 1e-08
gb|ECU72067.1| hypothetical protein GOS_3263074 [marine metagenome] 65.9 2e-08
gb|EBY13128.1| hypothetical protein GOS_4674838 [marine metagenome] 65.9 2e-08
gb|EBZ70750.1| hypothetical protein GOS_4266689 [marine metagenome] 65.9 2e-08
gb|ECM33736.1| hypothetical protein GOS_3321139 [marine metagenome] 65.9 2e-08
ref|ZP_02692651.1| flagellar M-ring protein FliF [Epulopiscium s... 65.5 3e-08
gb|EBF64051.1| hypothetical protein GOS_9564733 [marine metagenome] 65.1 3e-08
gb|ECG98756.1| hypothetical protein GOS_3568867 [marine metagenome] 64.7 5e-08
gb|EBI85227.1| hypothetical protein GOS_9023141 [marine metagenome] 64.3 5e-08
gb|EBG01119.1| hypothetical protein GOS_9504264 [marine metagenome] 64.3 6e-08
ref|ZP_00051978.1| COG1766: Flagellar biosynthesis/type III secr... 64.3 6e-08
gb|EDJ55297.1| hypothetical protein GOS_1675325 [marine metagenome] 63.9 7e-08
gb|EBH74687.1| hypothetical protein GOS_9209730 [marine metagenome] 63.9 7e-08
ref|ZP_02442271.1| hypothetical protein ANACOL_01561 [Anaerotrun... 63.9 7e-08
gb|EDI03773.1| hypothetical protein GOS_499580 [marine metagenome] 63.9 8e-08
gb|EDB39236.1| hypothetical protein GOS_1831940 [marine metagenome] 63.9 8e-08
gb|EBZ81651.1| hypothetical protein GOS_3839815 [marine metagenome] 63.9 8e-08
emb|CBL09114.1| flagellar basal-body M-ring protein/flagellar ho... 63.5 1e-07
gb|ECD54657.1| hypothetical protein GOS_3030432 [marine metagenome] 63.5 1e-07
ref|ZP_04744108.2| flagellar M-ring protein FliF [Roseburia inte... 63.2 1e-07
gb|EBU12530.1| hypothetical protein GOS_7162598 [marine metagenome] 63.2 1e-07
gb|EBV99219.1| hypothetical protein GOS_6818402 [marine metagenome] 63.2 1e-07
ref|ZP_07546429.1| Flagellar M-ring domain protein [Thermoanaero... 62.8 1e-07
gb|EBP36655.1| hypothetical protein GOS_7922964 [marine metagenome] 62.4 2e-07
gb|ECQ04465.1| hypothetical protein GOS_3694934 [marine metagenome] 62.4 2e-07
gb|EBJ42056.1| hypothetical protein GOS_8901258 [marine metagenome] 62.4 2e-07
gb|ECF07355.1| hypothetical protein GOS_4175722 [marine metagenome] 62.0 3e-07
gb|EDG22436.1| hypothetical protein GOS_818948 [marine metagenome] 62.0 3e-07
gb|EBT92774.1| hypothetical protein GOS_7193136 [marine metagenome] 61.6 3e-07
ref|ZP_02692700.1| flagellar M-ring protein FliF [Epulopiscium s... 61.6 4e-07
dbj|BAI85247.1| hypothetical protein BSNT_02643 [Bacillus subtil... 60.5 8e-07
gb|EBU46386.1| hypothetical protein GOS_7110605 [marine metagenome] 60.1 1e-06
gb|EBG61930.1| hypothetical protein GOS_9402702 [marine metagenome] 60.1 1e-06
ref|YP_002930263.1| flagellar M-ring protein FliF [Eubacterium e... 60.1 1e-06
gb|ECI70755.1| hypothetical protein GOS_3741096 [marine metagenome] 59.7 1e-06
gb|ECM85673.1| hypothetical protein GOS_4739672 [marine metagenome] 59.7 1e-06
gb|ECM85671.1| hypothetical protein GOS_4739670 [marine metagenome] 59.3 2e-06
gb|ECY26623.1| hypothetical protein GOS_2388952 [marine metagenome] 59.3 2e-06
gb|ECU48672.1| hypothetical protein GOS_4177049 [marine metagenome] 58.5 3e-06
gb|ECP77777.1| hypothetical protein GOS_4733625 [marine metagenome] 58.5 3e-06
gb|EBV64226.1| hypothetical protein GOS_6873291 [marine metagenome] 58.5 3e-06
gb|EBO62711.1| hypothetical protein GOS_8048526 [marine metagenome] 58.5 3e-06
ref|NP_541129.1| flagellar M-ring protein FLIF [Brucella meliten... 58.2 4e-06
gb|EBH22972.1| hypothetical protein GOS_9298543 [marine metagenome] 57.8 6e-06
ref|ZP_05453091.1| flagellar MS-ring protein [Brucella melitensi... 57.8 6e-06
gb|EBK48783.1| hypothetical protein GOS_8724435 [marine metagenome] 57.4 6e-06
ref|ZP_08402363.1| YscJ/HrcJ family type III secretion apparatus... 57.4 7e-06
ref|YP_001377945.1| secretory protein YscJ/FliF family protein [... 57.0 8e-06
ref|ZP_03506567.1| flagellar MS-ring protein [Rhizobium etli Bra... 56.6 1e-05
ref|YP_001779547.1| YscJ/HrcJ family type III secretion apparatu... 56.6 1e-05
gb|EBK43346.1| hypothetical protein GOS_8733626 [marine metagenome] 56.6 1e-05
gb|ECR27143.1| hypothetical protein GOS_5854246 [marine metagenome] 56.2 2e-05
gb|EBU75198.1| hypothetical protein GOS_7011657 [marine metagenome] 56.2 2e-05
gb|EBZ11866.1| hypothetical protein GOS_3150181 [marine metagenome] 55.8 2e-05
ref|ZP_01000494.1| flagellar M-ring protein [Oceanicola batsensi... 55.8 2e-05
gb|ECH23334.1| hypothetical protein GOS_6097496 [marine metagenome] 55.8 2e-05
gb|ECU68794.1| hypothetical protein GOS_3384244 [marine metagenome] 55.8 2e-05
gb|ECE60988.1| hypothetical protein GOS_6008421 [marine metagenome] 55.5 2e-05
gb|EBN83208.1| hypothetical protein GOS_8181042 [marine metagenome] 55.1 3e-05
ref|ZP_02534387.1| flagellar MS-ring protein [Endoriftia perseph... 55.1 4e-05
gb|EGH43725.1| flagellar MS-ring protein [Pseudomonas syringae p... 54.7 5e-05
gb|EBE96662.1| hypothetical protein GOS_9674934 [marine metagenome] 53.9 7e-05
ref|ZP_01037249.1| flagellar M-ring protein FliF [Roseovarius sp... 53.9 8e-05
gb|EBI57551.1| hypothetical protein GOS_9069487 [marine metagenome] 53.9 8e-05
ref|ZP_03244974.1| flagellar MS-ring protein [Helicobacter pylor... 53.9 8e-05
gb|ECF30213.1| hypothetical protein GOS_3273545 [marine metagenome] 53.9 9e-05
gb|ECY41522.1| hypothetical protein GOS_2364326 [marine metagenome] 53.5 9e-05
ref|ZP_02931211.1| type III secretion apparatus lipoprotein, Ysc... 53.5 9e-05
gb|ECK46443.1| hypothetical protein GOS_3755884 [marine metagenome] 53.5 1e-04
gb|ECT51312.1| hypothetical protein GOS_5672370 [marine metagenome] 53.1 1e-04
gb|ECO70577.1| hypothetical protein GOS_4363094 [marine metagenome] 53.1 1e-04
gb|EBB33118.1| hypothetical protein GOS_251485 [marine metagenome] 52.8 2e-04
gb|EBN84909.1| hypothetical protein GOS_8178152 [marine metagenome] 52.8 2e-04
ref|ZP_02534388.1| flagellar basal-body M-ring protein FliF [End... 52.8 2e-04
gb|EBG39738.1| hypothetical protein GOS_9439977 [marine metagenome] 52.8 2e-04
gb|ECN12897.1| hypothetical protein GOS_3657056 [marine metagenome] 52.4 2e-04
ref|ZP_02908147.1| type III secretion apparatus lipoprotein, Ysc... 52.4 2e-04
gb|ECR85185.1| hypothetical protein GOS_3549196 [marine metagenome] 52.4 2e-04
gb|ECH86143.1| hypothetical protein GOS_3581515 [marine metagenome] 52.0 3e-04
gb|ECF84835.1| hypothetical protein GOS_4599480 [marine metagenome] 52.0 3e-04
gb|ECQ26727.1| hypothetical protein GOS_6329406 [marine metagenome] 51.6 4e-04
ref|ZP_05083260.1| type III secretion apparatus lipoprotein, Ysc... 51.6 4e-04
ref|YP_002133110.1| secretory protein YscJ/FliF family protein [... 51.6 4e-04
gb|ECS42080.1| hypothetical protein GOS_4777820 [marine metagenome] 51.6 4e-04
gb|EBI85228.1| hypothetical protein GOS_9023142 [marine metagenome] 51.2 5e-04
ref|ZP_08267646.1| hypothetical protein BDIM_09830 [Brevundimona... 50.8 6e-04
gb|ECN16275.1| hypothetical protein GOS_3530884 [marine metagenome] 50.8 7e-04
emb|CBL40835.1| Flagellar biosynthesis/type III secretory pathwa... 50.4 8e-04
gb|EBY23912.1| hypothetical protein GOS_3416923 [marine metagenome] 50.4 8e-04
ref|ZP_03506049.1| flagellar MS-ring protein [Rhizobium etli Bra... 50.4 8e-04
gb|EDF42177.1| hypothetical protein GOS_958021 [marine metagenome] 50.4 9e-04
ref|YP_002888182.1| type III secretion system protein, membrane ... 50.4 0.001
gb|ECR99747.1| hypothetical protein GOS_6452695 [marine metagenome] 50.1 0.001
ref|YP_001653904.1| type III secretion system protein, membrane ... 50.1 0.001
ref|YP_001654892.1| type III secretion system protein, membrane ... 50.1 0.001
gb|EDB02670.1| hypothetical protein GOS_1894348 [marine metagenome] 50.1 0.001
emb|CCB86648.1| type III secretion periplasmic lipoprotein [Para... 50.1 0.001
ref|ZP_06299245.1| type III secretion lipoprotein SctJ [Parachla... 49.7 0.001
ref|ZP_05380946.1| type III secretion system protein, membrane c... 49.7 0.001
gb|ADI51235.1| type III secretion cytoplasmic membrane protein S... 49.7 0.001
ref|ZP_05353947.1| type III secretion system protein, membrane c... 49.7 0.001
ref|NP_220074.1| Yop proteins translocation lipoprotein J [Chlam... 49.7 0.001
gb|ECS19047.1| hypothetical protein GOS_5690006 [marine metagenome] 49.7 0.002
gb|EDJ09304.1| hypothetical protein GOS_1756201 [marine metagenome] 49.3 0.002
gb|EBD89936.1| hypothetical protein GOS_9854225 [marine metagenome] 49.3 0.002
gb|EBV66603.1| hypothetical protein GOS_6869432 [marine metagenome] 49.3 0.002
ref|ZP_01914330.1| putative type III secretion protein [Limnobac... 48.9 0.003
ref|ZP_01303336.1| hrp conserved lipoprotein hrcj transmembrane ... 48.5 0.003
gb|EFV87788.1| BscJ protein [Achromobacter xylosoxidans C54] 48.5 0.003
gb|EBD92160.1| hypothetical protein GOS_9850570 [marine metagenome] 48.5 0.003
gb|EBP94980.1| hypothetical protein GOS_7827793 [marine metagenome] 48.5 0.004
ref|ZP_07662858.1| type III secretion apparatus lipoprotein, Ysc... 48.1 0.004
gb|ECM14468.1| hypothetical protein GOS_4068529 [marine metagenome] 48.1 0.004
gb|EBY73532.1| hypothetical protein GOS_4636154 [marine metagenome] 48.1 0.005
gb|EBD53398.1| hypothetical protein GOS_9913837 [marine metagenome] 47.8 0.005
emb|CBL40836.1| Flagellar biosynthesis/type III secretory pathwa... 47.8 0.005
gb|EDJ66056.1| hypothetical protein GOS_1655939 [marine metagenome] 47.8 0.006
ref|YP_003811260.1| Type III secretion pathway protein [gamma pr... 47.4 0.007
ref|YP_002491164.1| secretory protein YscJ/FliF family protein [... 47.4 0.007
gb|AAG47968.1|AF312695_8 FliF [Pseudomonas fluorescens] 47.4 0.007
gb|EBW80649.1| hypothetical protein GOS_6688610 [marine metagenome] 47.4 0.008
gb|EBY34790.1| hypothetical protein GOS_6221411 [marine metagenome] 47.4 0.008
ref|ZP_03500771.1| flagellar MS-ring protein [Rhizobium etli Kim 5] 47.0 0.009
gb|EBA68954.1| hypothetical protein GOS_359160 [marine metagenom... 47.0 0.010
gb|ECJ17725.1| hypothetical protein GOS_5342326 [marine metagenome] 47.0 0.010
gb|ECR07605.1| hypothetical protein GOS_3137935 [marine metagenome] 46.6 0.011
gb|ECL55616.1| hypothetical protein GOS_6421120 [marine metagenome] 46.6 0.012
gb|EBE56064.1| hypothetical protein GOS_9743234 [marine metagenome] 46.6 0.013
gb|EBT91398.1| hypothetical protein GOS_7195320 [marine metagenome] 46.2 0.017
gb|EBQ69859.1| hypothetical protein GOS_7711501 [marine metagenome] 46.2 0.017
gb|EGH51094.1| type III secretion protein HrcJ [Pseudomonas syri... 46.2 0.017
gb|AAB05080.1| HrcJ [Pseudomonas syringae pv. syringae] 46.2 0.017
ref|ZP_06498918.1| type III secretion protein HrcJ [Pseudomonas ... 46.2 0.017
gb|EGH69184.1| type III secretion protein HrcJ [Pseudomonas syri... 46.2 0.018
ref|YP_234287.1| type III secretion protein HrcJ [Pseudomonas sy... 45.8 0.019
gb|EGH75918.1| type III secretion protein HrcJ [Pseudomonas syri... 45.8 0.019
emb|CBK74818.1| flagellar basal-body M-ring protein/flagellar ho... 45.8 0.020
gb|EGH41134.1| type III secretion protein HrcJ [Pseudomonas syri... 45.4 0.026
ref|YP_002824490.1| type III secretion component, RhcJ protein [... 45.4 0.028
gb|EGH57735.1| type III secretion protein HrcJ [Pseudomonas syri... 45.4 0.030
gb|ECJ14736.1| hypothetical protein GOS_5473136 [marine metagenome] 45.4 0.031
gb|EBN82368.1| hypothetical protein GOS_8182424 [marine metagenome] 45.1 0.031
gb|EBD09016.1| hypothetical protein GOS_9985800 [marine metagenome] 45.1 0.032
gb|ABB91658.1| type III secretion protein HrcJ [Pseudomonas syri... 45.1 0.032
gb|EBI68235.1| hypothetical protein GOS_9051419 [marine metagenome] 45.1 0.035
gb|EDE72160.1| hypothetical protein GOS_1081651 [marine metagenome] 45.1 0.035
gb|EGH27112.1| type III secretion protein HrcJ [Pseudomonas syri... 45.1 0.035
ref|YP_001888945.1| type III secretion apparatus lipoprotein, Ys... 45.1 0.039
ref|YP_463919.1| secretory protein YscJ/FliF [Anaeromyxobacter d... 44.7 0.042
gb|EGH83056.1| type III secretion protein HrcJ [Pseudomonas syri... 44.7 0.043
gb|ABL59995.1| SctJ [Lysobacter enzymogenes] 44.7 0.043
ref|NP_297221.1| type III secretion protein SctJ [Chlamydia muri... 44.7 0.048
gb|ECU65592.1| hypothetical protein GOS_3505963 [marine metagenome] 44.7 0.051
gb|EFS04021.1| flagellar M-ring protein FliF [Listeria seeligeri... 44.3 0.067
ref|YP_557905.1| secretory protein YscJ/FliF [Burkholderia xenov... 43.9 0.071
ref|ZP_07872962.1| flagellar M-ring protein FliF [Listeria ivano... 43.9 0.072
ref|ZP_01089536.1| probable polar flagellar M-ring protein FliF ... 43.9 0.072
ref|ZP_04588450.1| type III secretion protein HrcJ [Pseudomonas ... 43.9 0.073
ref|ZP_07005148.1| type III secretion system lipoprotein [Pseudo... 43.9 0.083
gb|EFS00945.1| flagellar M-ring protein FliF [Listeria seeligeri... 43.9 0.088
emb|CAQ57550.1| RhcJ protein [Bradyrhizobium elkanii] 43.9 0.090
>ref|NP_416448.1| flagellar basal-body MS-ring and collar protein [Escherichia
coli str. K-12 substr. MG1655]
ref|AP_002550.1| flagellar basal-body MS-ring and collar protein [Escherichia
coli str. K-12 substr. W3110]
ref|YP_001458727.1| flagellar MS-ring protein [Escherichia coli HS]
33 more sequence titles
Length=552
Score = 1120 bits (2896), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 552/552 (100%), Positives = 552/552 (100%), Gaps = 0/552 (0%)
Query 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
Query 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
Query 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
Query 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
Query 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
Query 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
Query 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
Query 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
Query 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
Query 541 LVIRQWINNDHE 552
LVIRQWINNDHE
Sbjct 541 LVIRQWINNDHE 552
>ref|YP_002412950.1| flagellar MS-ring protein [Escherichia coli UMN026]
ref|ZP_06649413.1| fliF [Escherichia coli FVEC1412]
ref|ZP_06990663.1| flagellar M-ring protein [Escherichia coli FVEC1302]
emb|CAR13421.1| flagellar basal-body MS-ring and collar protein [Escherichia
coli UMN026]
gb|EFF00656.1| fliF [Escherichia coli FVEC1412]
gb|EFI20020.1| flagellar M-ring protein [Escherichia coli FVEC1302]
Length=552
Score = 1119 bits (2894), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 551/552 (99%), Positives = 552/552 (100%), Gaps = 0/552 (0%)
Query 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
Query 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
Query 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
Query 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
Query 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
Query 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
Query 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
Query 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
SLNVVNSPFNSSDESGGELPFWQQQAFIDQL+AAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLMAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
Query 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
Query 541 LVIRQWINNDHE 552
LVIRQWINNDHE
Sbjct 541 LVIRQWINNDHE 552
>ref|ZP_03047436.1| flagellar M-ring protein FliF [Escherichia coli E22]
ref|ZP_03062458.1| flagellar M-ring protein FliF [Escherichia coli B171]
ref|ZP_07220930.1| flagellar M-ring protein FliF [Escherichia coli MS 78-1]
6 more sequence titles
Length=552
Score = 1119 bits (2894), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 551/552 (99%), Positives = 551/552 (99%), Gaps = 0/552 (0%)
Query 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
Query 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
Query 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
SQFSEQVNYQRALEGELSRTI TIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct 121 SQFSEQVNYQRALEGELSRTIATIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
Query 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
Query 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
Query 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
Query 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
Query 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
Query 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
Query 541 LVIRQWINNDHE 552
LVIRQWINNDHE
Sbjct 541 LVIRQWINNDHE 552
>ref|YP_310897.1| flagellar MS-ring protein [Shigella sonnei Ss046]
gb|AAZ88662.1| flagellar basal-body MS(membrane and supramembrane)-ring and
collar protein [Shigella sonnei Ss046]
gb|EFZ54623.1| flagellar M-ring protein FliF [Shigella sonnei 53G]
Length=552
Score = 1118 bits (2892), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 551/552 (99%), Positives = 551/552 (99%), Gaps = 0/552 (0%)
Query 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
Query 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
GAIVSQLTQMNIPY FSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct 61 GAIVSQLTQMNIPYCFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
Query 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
Query 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
Query 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
Query 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
Query 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
Query 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
Query 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
Query 541 LVIRQWINNDHE 552
LVIRQWINNDHE
Sbjct 541 LVIRQWINNDHE 552
>ref|YP_001463240.1| flagellar MS-ring protein [Escherichia coli E24377A]
gb|ABV20604.1| flagellar M-ring protein FliF [Escherichia coli E24377A]
Length=552
Score = 1118 bits (2892), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 550/552 (99%), Positives = 551/552 (99%), Gaps = 0/552 (0%)
Query 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
Query 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
Query 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
SQFSEQVNYQRALEGELSRTI TIGPVKGARVHLAMPKPSLFVREQKSPSASVT+NLLPG
Sbjct 121 SQFSEQVNYQRALEGELSRTIATIGPVKGARVHLAMPKPSLFVREQKSPSASVTINLLPG 180
Query 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
Query 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
Query 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
Query 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
Query 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
Query 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
Query 541 LVIRQWINNDHE 552
LVIRQWINNDHE
Sbjct 541 LVIRQWINNDHE 552
>ref|YP_001724683.1| flagellar MS-ring protein [Escherichia coli ATCC 8739]
ref|ZP_02999617.1| flagellar M-ring protein FliF [Escherichia coli 53638]
ref|ZP_07165396.1| flagellar M-ring protein FliF [Escherichia coli MS 116-1]
6 more sequence titles
Length=552
Score = 1118 bits (2891), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 551/552 (99%), Positives = 551/552 (99%), Gaps = 0/552 (0%)
Query 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
Query 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
Query 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
Query 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQ NTSGRDLNDAQLKYASDVEG
Sbjct 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQFNTSGRDLNDAQLKYASDVEG 240
Query 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
Query 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
Query 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
Query 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
Query 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
Query 541 LVIRQWINNDHE 552
LVIRQWINNDHE
Sbjct 541 LVIRQWINNDHE 552
>gb|AEE56998.1| flagellar M-ring protein FliF [Escherichia coli UMNK88]
Length=552
Score = 1117 bits (2889), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 550/552 (99%), Positives = 550/552 (99%), Gaps = 0/552 (0%)
Query 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
MNATAAQTKSLEWLNRLRANPKIPLIV GSAAVAVMVALILWAK PDYRTLFSNLSDQDG
Sbjct 1 MNATAAQTKSLEWLNRLRANPKIPLIVTGSAAVAVMVALILWAKTPDYRTLFSNLSDQDG 60
Query 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
Query 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
Query 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
Query 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
Query 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
Query 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct 361 DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD 420
Query 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct 421 SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA 480
Query 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct 481 EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA 540
Query 541 LVIRQWINNDHE 552
LVIRQWINNDHE
Sbjct 541 LVIRQWINNDHE 552
>gb|EFW50572.1| Flagellar M-ring protein FliF [Shigella dysenteriae CDC 74-1112]
Length=552
Score = 1117 bits (2889), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 550/552 (99%), Positives = 551/552 (99%), Gaps = 0/552 (0%)
Query 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct 1 MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60
Query 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct 61 GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI 120
Query 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct 121 SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG 180
Query 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct 181 RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG 240
Query 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct 241 RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ 300
Query 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV 360
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct 301 SGSGYPGGVPGALSNQPAPANNAPISTPPANQNN