Blast performed on February-3-2012
BLASTP 2.2.24+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: nr_env
           20,512,688 sequences; 6,167,035,527 total letters



Query=  EG11347 fliF 
Length=552
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_416448.1|  flagellar basal-body MS-ring and collar protein...  1120    0.0   
ref|YP_002412950.1|  flagellar MS-ring protein [Escherichia coli ...  1119    0.0   
ref|ZP_03047436.1|  flagellar M-ring protein FliF [Escherichia co...  1119    0.0   
ref|YP_310897.1|  flagellar MS-ring protein [Shigella sonnei Ss04...  1118    0.0   
ref|YP_001463240.1|  flagellar MS-ring protein [Escherichia coli ...  1118    0.0   
ref|YP_001724683.1|  flagellar MS-ring protein [Escherichia coli ...  1118    0.0   
gb|AEE56998.1|  flagellar M-ring protein FliF [Escherichia coli U...  1117    0.0   
gb|EFW50572.1|  Flagellar M-ring protein FliF [Shigella dysenteri...  1117    0.0   
ref|ZP_07592110.1|  flagellar M-ring protein FliF [Escherichia co...  1117    0.0   
ref|YP_002398145.1|  flagellar MS-ring protein [Escherichia coli ...  1117    0.0   
ref|YP_002293444.1|  flagellar MS-ring protein [Escherichia coli ...  1117    0.0   
ref|ZP_07690368.1|  flagellar M-ring protein FliF [Escherichia co...  1116    0.0   
ref|YP_003222115.1|  flagellar basal-body MS-ring and collar prot...  1116    0.0   
ref|ZP_05431734.1|  flagellar MS-ring protein [Shigella sp. D9] >...  1116    0.0   
ref|YP_407544.1|  flagellar MS-ring protein [Shigella boydii Sb22...  1116    0.0   
ref|ZP_03030081.1|  flagellar M-ring protein FliF [Escherichia co...  1116    0.0   
gb|EGB36594.1|  flagellar M-ring protein FliF [Escherichia coli E...  1115    0.0   
ref|ZP_07136607.1|  flagellar M-ring protein FliF [Escherichia co...  1115    0.0   
ref|ZP_06653870.1|  flagellar M-ring protein FliF [Escherichia co...  1115    0.0   
ref|ZP_03071649.1|  flagellar M-ring protein FliF [Escherichia co...  1115    0.0   
dbj|BAA14029.1|  FliF [Escherichia coli W3110]                        1115    0.0   
gb|EFW57630.1|  Flagellar M-ring protein FliF [Shigella boydii AT...  1114    0.0   
ref|ZP_08374220.1|  flagellar M-ring protein FliF [Escherichia co...  1114    0.0   
gb|EGB44345.1|  flagellar M-ring protein FliF [Escherichia coli H...  1114    0.0   
gb|EGB75082.1|  flagellar M-ring protein FliF [Escherichia coli M...  1113    0.0   
gb|EGB57581.1|  flagellar M-ring protein FliF [Escherichia coli H...  1113    0.0   
ref|ZP_07788017.1|  flagellar M-ring protein FliF [Escherichia co...  1113    0.0   
ref|NP_288399.1|  flagellar MS-ring protein [Escherichia coli O15...  1113    0.0   
ref|ZP_08354355.1|  flagellar M-ring protein FliF [Escherichia co...  1112    0.0   
ref|ZP_07098850.1|  flagellar M-ring protein FliF [Escherichia co...  1112    0.0   
ref|ZP_05436269.1|  flagellar MS-ring protein [Escherichia sp. 4_...  1112    0.0   
ref|NP_754246.1|  flagellar MS-ring protein [Escherichia coli CFT...  1112    0.0   
gb|EGB72967.1|  flagellar M-ring protein FliF [Escherichia coli T...  1111    0.0   
ref|ZP_08384091.1|  flagellar M-ring protein FliF [Escherichia co...  1111    0.0   
ref|ZP_08358946.1|  flagellar M-ring protein FliF [Escherichia co...  1111    0.0   
ref|ZP_07497961.1|  flagellar MS-ring protein [Escherichia coli H...  1110    0.0   
gb|EGB63761.1|  flagellar M-ring protein FliF [Escherichia coli M...  1110    0.0   
ref|YP_541142.1|  flagellar MS-ring protein [Escherichia coli UTI...  1110    0.0   
gb|ADR27358.1|  flagellar MS-ring protein [Escherichia coli O83:H...  1109    0.0   
ref|ZP_07139914.1|  flagellar M-ring protein FliF [Escherichia co...  1109    0.0   
dbj|BAI55330.1|  flagellar hook-basal body MS ring protein FliF [...  1109    0.0   
ref|YP_002403210.1|  flagellar MS-ring protein [Escherichia coli ...  1109    0.0   
ref|YP_669774.1|  flagellar MS-ring protein [Escherichia coli 536...  1109    0.0   
gb|EFU55769.1|  flagellar M-ring protein FliF [Escherichia coli M...  1108    0.0   
ref|YP_003234933.1|  flagellar basal-body MS-ring and collar prot...  1108    0.0   
ref|YP_002407131.1|  flagellar MS-ring protein [Escherichia coli ...  1108    0.0   
gb|EGB82712.1|  flagellar M-ring protein FliF [Escherichia coli M...  1108    0.0   
gb|EFW68980.1|  Flagellar M-ring protein FliF [Escherichia coli W...  1106    0.0   
ref|ZP_08348624.1|  flagellar M-ring protein FliF [Escherichia co...  1106    0.0   
emb|CAP76418.1|  flagellar M-ring protein [Escherichia coli LF82]     1106    0.0   
gb|AEG36844.1|  Flagellar hook basal body MS-ring protein [Escher...  1105    0.0   
gb|EFZ72134.1|  flagellar M-ring protein FliF [Escherichia coli R...  1104    0.0   
ref|ZP_07122654.1|  flagellar M-ring protein FliF [Escherichia co...  1100    0.0   
ref|ZP_07117471.1|  flagellar M-ring protein FliF [Escherichia co...  1031    0.0   
ref|ZP_07146498.1|  flagellar M-ring protein FliF [Escherichia co...  1031    0.0   
gb|EGC08192.1|  flagellar M-ring protein FliF [Escherichia fergus...  1030    0.0   
ref|YP_002383054.1|  flagellar MS-ring protein [Escherichia fergu...  1028    0.0   
gb|EGB88065.1|  flagellar M-ring protein FliF [Escherichia coli M...  1028    0.0   
gb|EFU46099.1|  flagellar M-ring protein FliF [Escherichia coli M...  1021    0.0   
ref|ZP_07180829.1|  flagellar M-ring protein FliF [Escherichia co...  1018    0.0   
ref|ZP_02903895.1|  flagellar M-ring protein FliF [Escherichia al...  1006    0.0   
ref|YP_001452587.1|  flagellar MS-ring protein [Citrobacter koser...   984    0.0   
gb|EFY13870.1|  flagellar MS-ring protein [Salmonella enterica su...   982    0.0   
ref|NP_456530.1|  flagellar MS-ring protein [Salmonella enterica ...   981    0.0   
ref|YP_001570021.1|  flagellar MS-ring protein [Salmonella enteri...   980    0.0   
ref|ZP_03164293.1|  flagellar M-ring protein FliF [Salmonella ent...   964    0.0   
ref|YP_002215117.1|  flagellar MS-ring protein [Salmonella enteri...   962    0.0   
ref|ZP_04562467.1|  flagellar MS-ring protein [Citrobacter sp. 30...   962    0.0   
ref|ZP_03075847.1|  flagellar M-ring protein FliF [Salmonella ent...   962    0.0   
ref|YP_002046020.1|  flagellar MS-ring protein [Salmonella enteri...   961    0.0   
ref|ZP_04656295.1|  flagellar MS-ring protein [Salmonella enteric...   960    0.0   
ref|NP_460922.1|  flagellar MS-ring protein [Salmonella enterica ...   959    0.0   
ref|YP_002146054.1|  flagellar MS-ring protein [Salmonella enteri...   959    0.0   
ref|YP_002041234.1|  flagellar MS-ring protein [Salmonella enteri...   959    0.0   
ref|ZP_02681717.2|  flagellar M-ring protein FliF [Salmonella ent...   959    0.0   
ref|YP_002637330.1|  flagellar MS-ring protein [Salmonella enteri...   958    0.0   
ref|YP_002243169.1|  flagellar MS-ring protein [Salmonella enteri...   957    0.0   
ref|ZP_02835012.2|  flagellar M-ring protein FliF [Salmonella ent...   957    0.0   
ref|NP_804737.1|  flagellar MS-ring protein [Salmonella enterica ...   956    0.0   
emb|CBY95193.1|  Flagellar M-ring protein [Salmonella enterica su...   955    0.0   
ref|YP_150193.1|  flagellar MS-ring protein [Salmonella enterica ...   955    0.0   
ref|YP_216961.1|  flagellar MS-ring protein [Salmonella enterica ...   954    0.0   
ref|ZP_02346550.2|  flagellar M-ring protein FliF [Salmonella ent...   950    0.0   
ref|YP_002226138.1|  flagellar MS-ring protein [Salmonella enteri...   949    0.0   
ref|ZP_06352408.2|  flagellar M-ring protein FliF [Citrobacter yo...   945    0.0   
gb|EFY51826.1|  flagellar MS-ring protein [Salmonella enterica su...   943    0.0   
ref|YP_003613704.1|  flagellar MS-ring protein [Enterobacter cloa...   940    0.0   
ref|ZP_03353031.1|  flagellar MS-ring protein [Salmonella enteric...   937    0.0   
ref|ZP_08498679.1|  flagellar M-ring protein [Enterobacter hormae...   937    0.0   
ref|YP_003941351.1|  flagellar M-ring protein FliF [Enterobacter ...   933    0.0   
gb|EFX49677.1|  Flagellar M-ring protein FliF [Salmonella enteric...   928    0.0   
gb|EGE29210.1|  flagellar M-ring protein FliF [Salmonella enteric...   926    0.0   
gb|EGJ00512.1|  flagellar M-ring protein FliF [Shigella dysenteri...   926    0.0   
ref|YP_001587427.1|  flagellar MS-ring protein [Salmonella enteri...   926    0.0   
ref|YP_003365573.1|  flagellar M-ring protein [Citrobacter rodent...   924    0.0   
ref|ZP_03346035.1|  flagellar MS-ring protein [Salmonella enteric...   924    0.0   
ref|YP_001177249.1|  flagellar MS-ring protein [Enterobacter sp. ...   923    0.0   
emb|CBK87382.1|  flagellar basal-body M-ring protein/flagellar ho...   911    0.0   
ref|ZP_05968261.2|  flagellar M-ring protein FliF [Enterobacter c...   888    0.0   
ref|YP_001437358.1|  flagellar MS-ring protein [Cronobacter sakaz...   868    0.0   
ref|YP_003211018.1|  flagellar MS-ring protein [Cronobacter turic...   864    0.0   
gb|EGL74469.1|  flagellar MS-ring protein [Cronobacter sakazakii ...   835    0.0   
gb|EFZ60303.1|  flagellar M-ring protein FliF [Escherichia coli L...   762    0.0   
ref|YP_003742034.1|  flagellar basal-body M-ring protein [Erwinia...   759    0.0   
ref|YP_004116247.1|  flagellar M-ring protein FliF [Pantoea sp. A...   759    0.0   
dbj|BAK11686.1|  flagellar M-ring protein FliF [Pantoea ananatis ...   731    0.0   
ref|YP_001907917.1|  flagellar MS-ring protein [Erwinia tasmanien...   731    0.0   
ref|ZP_07380725.1|  flagellar M-ring protein FliF [Pantoea sp. aB...   729    0.0   
ref|YP_003520590.1|  FliF [Pantoea ananatis LMG 20103] >gb|ADD774...   726    0.0   
ref|YP_004213223.1|  flagellar M-ring protein FliF [Rahnella sp. ...   720    0.0   
ref|YP_003530869.1|  flagellar M-ring protein FliF [Erwinia amylo...   715    0.0   
ref|ZP_03357756.1|  flagellar MS-ring protein [Salmonella enteric...   714    0.0   
ref|ZP_06536456.1|  flagellar MS-ring protein [Salmonella enteric...   712    0.0   
ref|YP_002649114.1|  flagellar MS-ring protein [Erwinia pyrifolia...   709    0.0   
ref|YP_003931421.1|  flagellar M-ring protein [Pantoea vagans C9-...   709    0.0   
gb|ADP12294.1|  flagellar MS-ring protein [Erwinia sp. Ejp617]         704    0.0   
ref|ZP_08255930.1|  flagellar MS-ring protein [Plautia stali symb...   703    0.0   
ref|ZP_04616651.1|  Flagellar M-ring protein [Yersinia ruckeri AT...   698    0.0   
ref|YP_003883605.1|  flagellar M-ring protein fliF [Dickeya dadan...   686    0.0   
ref|YP_002987162.1|  flagellar MS-ring protein [Dickeya dadantii ...   686    0.0   
ref|ZP_04642049.1|  Flagellar M-ring protein [Yersinia mollaretii...   684    0.0   
ref|ZP_04632126.1|  Flagellar M-ring protein [Yersinia frederikse...   682    0.0   
ref|YP_070230.1|  flagellar MS-ring protein [Yersinia pseudotuber...   681    0.0   
ref|NP_669782.1|  flagellar MS-ring protein [Yersinia pestis KIM ...   681    0.0   
ref|ZP_04637633.1|  Flagellar M-ring protein [Yersinia intermedia...   680    0.0   
ref|YP_001006741.1|  flagellar MS-ring protein [Yersinia enteroco...   680    0.0   
ref|ZP_04613268.1|  Flagellar M-ring protein [Yersinia rohdei ATC...   679    0.0   
ref|YP_001721121.1|  flagellar MS-ring protein [Yersinia pseudotu...   679    0.0   
ref|YP_001872256.1|  flagellar MS-ring protein [Yersinia pseudotu...   679    0.0   
ref|ZP_04628730.1|  Flagellar M-ring protein [Yersinia bercovieri...   679    0.0   
ref|YP_004297919.1|  flagellar MS-ring protein [Yersinia enteroco...   678    0.0   
emb|CBY26761.1|  flagellar M-ring protein FliF [Yersinia enteroco...   677    0.0   
ref|ZP_07950837.1|  flagellar M-ring protein FliF [Enterobacteria...   672    0.0   
ref|ZP_04619272.1|  Flagellar M-ring protein [Yersinia aldovae AT...   672    0.0   
ref|YP_003333111.1|  flagellar M-ring protein FliF [Dickeya dadan...   671    0.0   
ref|YP_001479176.1|  flagellar MS-ring protein [Serratia proteama...   670    0.0   
ref|YP_004501457.1|  flagellar M-ring protein FliF [Serratia sp. ...   670    0.0   
ref|ZP_06190651.1|  flagellar M-ring protein FliF [Serratia odori...   669    0.0   
ref|YP_003003909.1|  flagellar MS-ring protein [Dickeya zeae Ech1...   669    0.0   
ref|ZP_04625838.1|  Flagellar M-ring protein [Yersinia kristensen...   667    0.0   
ref|YP_852991.1|  flagellar M-ring protein [Escherichia coli APEC...   662    0.0   
ref|YP_003296188.1|  flagellar biosynthesis/type III secretory pa...   658    0.0   
ref|YP_002933826.1|  flagellar MS-ring protein [Edwardsiella icta...   654    0.0   
ref|ZP_03343214.1|  flagellar MS-ring protein [Salmonella enteric...   650    0.0   
ref|ZP_06639886.1|  flagellar M-ring protein [Serratia odorifera ...   648    0.0   
ref|YP_003259279.1|  flagellar MS-ring protein [Pectobacterium wa...   647    0.0   
ref|YP_003018142.1|  flagellar M-ring protein FliF [Pectobacteriu...   646    0.0   
ref|NP_929215.1|  flagellar MS-ring protein [Photorhabdus lumines...   643    0.0   
ref|ZP_03826197.1|  flagellar MS-ring protein [Pectobacterium car...   642    0.0   
ref|YP_049826.1|  flagellar MS-ring protein [Pectobacterium atros...   640    0.0   
ref|ZP_03833962.1|  flagellar MS-ring protein [Pectobacterium car...   639    0.0   
ref|YP_002151361.1|  flagellar MS-ring protein [Proteus mirabilis...   634    1e-179
ref|ZP_03840372.1|  flagellar M-ring protein [Proteus mirabilis A...   633    2e-179
ref|YP_003041450.1|  flagellar MS-ring protein [Photorhabdus asym...   632    4e-179
gb|EGA09449.1|  flagellar MS-ring protein [Salmonella enterica su...   630    2e-178
ref|YP_004593347.1|  flagellar MS-ring protein [Enterobacter aero...   619    6e-175
ref|YP_003711930.1|  flagellar basal-body MS-ring and collar prot...   611    1e-172
ref|ZP_04640436.1|  Flagellar M-ring protein [Yersinia mollaretii...   603    2e-170
ref|YP_003468592.1|  flagellar basal-body MS(membrane and suprame...   597    2e-168
ref|ZP_03375722.1|  flagellar MS-ring protein [Salmonella enteric...   580    2e-163
ref|ZP_04626851.1|  Flagellar M-ring protein [Yersinia bercovieri...   573    3e-161
ref|ZP_03317640.1|  hypothetical protein PROVALCAL_00554 [Provide...   571    1e-160
ref|ZP_06124181.1|  flagellar M-ring protein FliF [Providencia re...   568    1e-159
ref|ZP_05971764.1|  flagellar M-ring protein FliF [Providencia ru...   558    1e-156
ref|ZP_04511446.1|  Flagellar M-ring protein fliF [Yersinia pesti...   557    2e-156
emb|CBA72437.1|  flagellar M-ring protein FliF [Arsenophonus naso...   556    3e-156
ref|YP_003532049.1|  flagellar M-ring protein FliF [Erwinia amylo...   552    7e-155
ref|YP_002647962.1|  flagellar basal-body M-ring protein [Erwinia...   546    5e-153
gb|ECH37350.1|  hypothetical protein GOS_5509244 [marine metagenome]   545    6e-153
gb|ADP09838.1|  Flagellar basal-body M-ring protein [Erwinia sp. ...   545    1e-152
ref|ZP_02960147.1|  hypothetical protein PROSTU_02060 [Providenci...   542    7e-152
gb|EBT79075.1|  hypothetical protein GOS_7215404 [marine metagenome]   533    4e-149
emb|CBK86316.1|  flagellar basal-body M-ring protein/flagellar ho...   533    4e-149
gb|EGK23575.1|  flagellar M-ring protein domain protein [Shigella...   527    2e-147
gb|EGJ86445.1|  flagellar M-ring protein domain protein [Shigella...   525    8e-147
gb|EGK22587.1|  flagellar M-ring protein domain protein [Shigella...   525    9e-147
ref|ZP_06715198.1|  flagellar M-ring protein FliF [Edwardsiella t...   522    6e-146
gb|EFS14571.1|  flagellar M-ring domain protein [Shigella flexner...   516    4e-144
ref|YP_453733.1|  flagellar basal-body M-ring protein FliF [Sodal...   513    3e-143
ref|YP_370651.1|  flagellar MS-ring protein [Burkholderia sp. 383...   503    4e-140
gb|ECV29049.1|  hypothetical protein GOS_2927516 [marine metagenome]   497    2e-138
ref|YP_299289.1|  flagellar MS-ring protein [Ralstonia eutropha J...   496    4e-138
ref|YP_587389.1|  flagellar MS-ring protein [Cupriavidus metallid...   495    1e-137
ref|ZP_02887869.1|  flagellar M-ring protein FliF [Burkholderia g...   492    9e-137
ref|YP_004229845.1|  flagellar M-ring protein FliF [Burkholderia ...   490    3e-136
ref|ZP_02891802.1|  flagellar M-ring protein FliF [Burkholderia a...   490    3e-136
ref|YP_002229686.1|  flagellar MS-ring protein [Burkholderia ceno...   488    1e-135
ref|ZP_04940246.1|  Flagellar biosynthesis/type III secretory pat...   487    2e-135
ref|YP_774999.1|  flagellar MS-ring protein [Burkholderia ambifar...   486    5e-135
ref|YP_001809667.1|  flagellar MS-ring protein [Burkholderia ambi...   486    6e-135
ref|YP_002008773.1|  flagellar ms-ring protein [Cupriavidus taiwa...   486    7e-135
ref|YP_003908566.1|  flagellar M-ring protein FliF [Burkholderia ...   485    8e-135
ref|ZP_04944475.1|  Flagellar biosynthesis/type III secretory pat...   485    1e-134
ref|ZP_02910625.1|  flagellar M-ring protein FliF [Burkholderia a...   484    1e-134
ref|YP_622322.1|  flagellar MS-ring protein [Burkholderia cenocep...   484    2e-134
ref|YP_001897382.1|  flagellar MS-ring protein [Burkholderia phyt...   481    1e-133
ref|YP_560817.1|  flagellar MS-ring protein [Burkholderia xenovor...   481    2e-133
ref|YP_001120975.1|  flagellar MS-ring protein [Burkholderia viet...   479    4e-133
ref|YP_001859148.1|  flagellar MS-ring protein [Burkholderia phym...   476    3e-132
ref|ZP_03588738.1|  flagellar M-ring protein FliF [Burkholderia m...   476    4e-132
ref|ZP_06840267.1|  flagellar M-ring protein FliF [Burkholderia s...   476    7e-132
ref|YP_001581242.1|  flagellar MS-ring protein [Burkholderia mult...   475    8e-132
gb|EGM61553.1|  hypothetical protein SFJ1713_2268 [Shigella flexn...   475    1e-131
ref|YP_001353131.1|  flagellar MS-ring protein [Janthinobacterium...   474    2e-131
ref|ZP_03574976.1|  flagellar M-ring protein FliF [Burkholderia m...   473    4e-131
ref|ZP_08553058.1|  flagellar MS-ring protein [Salinisphaera shab...   470    3e-130
ref|ZP_03270859.1|  flagellar M-ring protein FliF [Burkholderia s...   469    4e-130
ref|YP_841880.1|  flagellar MS-ring protein [Ralstonia eutropha H...   469    5e-130
ref|YP_440758.3|  flagellar MS-ring protein [Burkholderia thailan...   468    1e-129
ref|ZP_02386167.1|  flagellar MS-ring protein [Burkholderia thail...   468    1e-129
gb|ABA50977.1|  flagellar M-ring protein FliF [Burkholderia pseud...   464    1e-128
emb|CAD22875.1|  basal-body M-ring protein [Erwinia chrysanthemi]      464    2e-128
ref|YP_002894863.1|  flagellar M-ring protein FliF [Burkholderia ...   464    2e-128
ref|YP_001057275.1|  flagellar MS-ring protein [Burkholderia pseu...   464    2e-128
ref|YP_106858.1|  flagellar MS-ring protein [Burkholderia pseudom...   464    2e-128
ref|ZP_02469360.1|  flagellar MS-ring protein [Burkholderia pseud...   464    2e-128
ref|ZP_02496156.1|  flagellar MS-ring protein [Burkholderia pseud...   464    3e-128
ref|ZP_02445422.1|  flagellar MS-ring protein [Burkholderia pseud...   463    4e-128
ref|ZP_02361239.1|  flagellar MS-ring protein [Burkholderia oklah...   462    7e-128
ref|ZP_02372314.1|  flagellar MS-ring protein [Burkholderia thail...   462    8e-128
ref|YP_002913118.1|  flagellar MS-ring protein [Burkholderia glum...   460    2e-127
ref|ZP_02380919.1|  flagellar MS-ring protein [Burkholderia ubone...   460    3e-127
ref|ZP_02488054.1|  flagellar MS-ring protein [Burkholderia pseud...   460    3e-127
ref|ZP_02504197.1|  flagellar MS-ring protein [Burkholderia pseud...   459    4e-127
ref|ZP_02453729.1|  flagellar MS-ring protein [Burkholderia pseud...   459    4e-127
ref|ZP_02479755.1|  flagellar MS-ring protein [Burkholderia pseud...   459    5e-127
ref|ZP_02354064.1|  flagellar MS-ring protein [Burkholderia oklah...   459    5e-127
ref|ZP_02400838.1|  flagellar MS-ring protein [Burkholderia pseud...   459    6e-127
ref|ZP_00440272.1|  flagellar M-ring protein FliF [Burkholderia m...   459    9e-127
ref|YP_002946047.1|  flagellar MS-ring protein [Variovorax parado...   458    1e-126
ref|YP_001100151.1|  flagellar MS-ring protein [Herminiimonas ars...   457    2e-126
emb|CAL62027.2|  Flagellar M-ring protein [Herminiimonas arsenico...   457    2e-126
ref|ZP_02461940.1|  flagellar MS-ring protein [Burkholderia thail...   456    7e-126
gb|AAL65160.1|AF453480_2  flagellar MS ring protein [Burkholderia...   455    9e-126
gb|AAU48881.1|  flagellar M-ring protein FliF [Burkholderia malle...   454    1e-125
ref|ZP_02409419.1|  flagellar MS-ring protein [Burkholderia pseud...   452    6e-125
ref|YP_283999.1|  flagellar MS-ring protein [Dechloromonas aromat...   449    5e-124
ref|YP_004293593.1|  flagellar M-ring protein FliF [Nitrosomonas ...   447    2e-123
ref|YP_004362327.1|  Flagellar M-ring protein FliF [Burkholderia ...   447    2e-123
ref|YP_003606549.1|  flagellar M-ring protein FliF [Burkholderia ...   445    9e-123
gb|EGK22588.1|  flagellar M-ring protein domain protein [Shigella...   444    2e-122
ref|ZP_03699734.1|  flagellar M-ring protein FliF [Lutiella nitro...   444    2e-122
ref|ZP_06687421.1|  flagellar M-ring protein FliF [Achromobacter ...   444    2e-122
ref|YP_003846863.1|  flagellar M-ring protein FliF [Gallionella c...   444    3e-122
ref|YP_004039201.1|  flagellar m-ring protein flif [Methylovorus ...   444    3e-122
ref|YP_003050531.1|  flagellar M-ring protein FliF [Methylovorus ...   443    3e-122
ref|YP_786234.1|  flagellar MS-ring protein [Bordetella avium 197...   443    4e-122
gb|EGK23576.1|  flagellar M-ring protein domain protein [Shigella...   442    5e-122
ref|YP_003048363.1|  flagellar M-ring protein FliF [Methylotenera...   440    4e-121
ref|NP_880146.1|  flagellar MS-ring protein [Bordetella pertussis...   439    5e-121
ref|NP_889125.1|  flagellar MS-ring protein [Bordetella bronchise...   439    7e-121
ref|ZP_07674247.1|  flagellar M-ring protein FliF [Ralstonia sp. ...   439    8e-121
ref|YP_574006.1|  flagellar M-ring protein FliF [Chromohalobacter...   438    1e-120
ref|ZP_08272776.1|  Flagellar M-ring protein fliF [Oxalobacterace...   438    1e-120
ref|YP_412040.1|  flagellar MS-ring protein [Nitrosospira multifo...   437    3e-120
ref|NP_902806.1|  flagellar M-ring protein [Chromobacterium viola...   436    4e-120
ref|YP_003775467.1|  hypothetical protein Hsero_2059 [Herbaspiril...   435    1e-119
ref|YP_001630756.1|  flagellar MS-ring protein [Bordetella petrii...   434    1e-119
ref|YP_003978813.1|  flagellar M-ring protein FliF [Achromobacter...   434    3e-119
ref|NP_871063.1|  hypothetical protein WGLp060 [Wigglesworthia gl...   431    2e-118
ref|YP_746980.1|  flagellar M-ring protein FliF [Nitrosomonas eut...   428    1e-117
ref|YP_003673963.1|  flagellar M-ring protein FliF [Methylotenera...   427    3e-117
ref|YP_003899428.1|  flagellar MS-ring protein [Halomonas elongat...   425    9e-117
ref|YP_003747621.1|  FliF: flagellar biosynthesis protein, M-ring...   425    1e-116
ref|YP_001893242.1|  flagellar M-ring protein FliF [Ralstonia pic...   425    1e-116
ref|YP_315358.1|  flagellar MS-ring protein [Thiobacillus denitri...   424    2e-116
ref|ZP_08503331.1|  Flagellar M-ring protein [Methyloversatilis u...   423    3e-116
gb|EFV86471.1|  flagellar M-ring protein FliF [Achromobacter xylo...   423    4e-116
ref|YP_004415953.1|  flagellar MS-ring protein [Pusillimonas sp. ...   423    5e-116
gb|ADP67048.1|  flagellar MS-ring protein [Buchnera aphidicola st...   423    5e-116
gb|ADP67623.1|  flagellar MS-ring protein [Buchnera aphidicola st...   422    6e-116
ref|YP_003168979.1|  flagellar MS-ring protein [Candidatus Accumu...   422    8e-116
ref|YP_002467837.1|  flagellar M-ring protein [Buchnera aphidicol...   422    9e-116
ref|ZP_01916408.1|  flagellar M-ring protein FliF [Limnobacter sp...   422    1e-115
ref|YP_003523225.1|  flagellar M-ring protein FliF [Sideroxydans ...   421    1e-115
ref|NP_239907.1|  flagellar MS-ring protein [Buchnera aphidicola ...   421    2e-115
ref|NP_842093.1|  fliF; flagellar M-ring transmembrane protein [N...   420    4e-115
gb|AEG72079.1|  flagellar m-ring protein [Ralstonia solanacearum ...   419    7e-115
ref|ZP_03386013.1|  flagellar MS-ring protein [Salmonella enteric...   419    7e-115
emb|CBJ40017.1|  FliF: Flagellar biosynthesis protein, M-ring pro...   419    1e-114
ref|YP_002256768.1|  flagellar m-ring protein [Ralstonia solanace...   417    2e-114
ref|YP_002796352.1|  FliF1 [Laribacter hongkongensis HLHK9] >gb|A...   417    2e-114
ref|ZP_00944664.1|  FliF [Ralstonia solanacearum UW551] >ref|YP_0...   416    7e-114
ref|YP_934219.1|  flagellar MS-ring protein [Azoarcus sp. BH72] >...   416    8e-114
ref|YP_546086.1|  flagellar M-ring protein FliF [Methylobacillus ...   414    2e-113
ref|NP_521951.1|  flagellar M-ring transmembrane protein [Ralston...   414    2e-113
ref|YP_003749337.1|  flif: flagellar biosynthesis protein, m-ring...   412    7e-113
ref|ZP_08620812.1|  flagellar basal-body M-ring protein/flagellar...   410    4e-112
ref|YP_002799585.1|  flagellar M-ring protein [Azotobacter vinela...   407    3e-111
ref|ZP_04761705.1|  flagellar M-ring protein FliF [Acidovorax del...   399    5e-109
gb|ADP65897.1|  flagellar MS-ring protein [Buchnera aphidicola st...   399    6e-109
ref|ZP_08407037.1|  flagellar M-ring protein FliF [Hylemonella gr...   397    2e-108
ref|ZP_08018438.1|  flagellar basal-body M-ring protein FliF [Lau...   397    3e-108
ref|NP_660426.1|  flagellar MS-ring protein [Buchnera aphidicola ...   395    1e-107
ref|YP_972709.1|  flagellar M-ring protein FliF [Acidovorax citru...   391    2e-106
ref|YP_987990.1|  flagellar M-ring protein FliF [Acidovorax sp. J...   391    2e-106
ref|YP_002554514.1|  flagellar m-ring protein flif [Acidovorax eb...   391    2e-106
ref|YP_004236743.1|  flagellar M-ring protein FliF [Acidovorax av...   389    7e-106
gb|EDA95724.1|  hypothetical protein GOS_1906171 [marine metagenome]   388    2e-105
ref|YP_995905.1|  flagellar M-ring protein FliF [Verminephrobacte...   388    2e-105
ref|YP_001561669.1|  flagellar M-ring protein FliF [Delftia acido...   386    5e-105
ref|YP_004485970.1|  flagellar M-ring protein FliF [Delftia sp. C...   384    2e-104
ref|YP_003761358.1|  flagellar M-ring protein FliF [Nitrosococcus...   381    2e-103
ref|ZP_03545403.1|  flagellar M-ring protein FliF [Comamonas test...   380    5e-103
gb|EAY73221.1|  hypothetical protein OsI_01094 [Oryza sativa Indi...   379    8e-103
ref|YP_344347.1|  flagellar FliF M-ring protein [Nitrosococcus oc...   377    2e-102
emb|CBA31986.1|  hypothetical protein Csp_D29860 [Curvibacter put...   377    2e-102
ref|YP_004128452.1|  flagellar m-ring protein flif [Alicycliphilu...   376    6e-102
ref|YP_003276500.1|  flagellar M-ring protein FliF [Comamonas tes...   375    8e-102
ref|YP_001790052.1|  flagellar M-ring protein FliF [Leptothrix ch...   375    1e-101
gb|EGD04395.1|  flagellar MS-ring protein [Burkholderia sp. TJI49]     374    3e-101
ref|YP_001019762.1|  flagellar biosynthesis lipoprotein [Methylib...   372    8e-101
ref|YP_521832.1|  flagellar M-ring protein FliF [Rhodoferax ferri...   371    2e-100
ref|ZP_08403040.1|  flagellar M-ring protein FliF [Rubrivivax ben...   368    2e-99 
ref|ZP_08535268.1|  flagellar biosynthesis/type III secretory pat...   368    2e-99 
ref|YP_003527820.1|  flagellar M-ring protein FliF [Nitrosococcus...   368    2e-99 
ref|YP_003642933.1|  flagellar M-ring protein FliF [Thiomonas int...   365    8e-99 
ref|YP_002889875.1|  flagellar MS-ring protein [Thauera sp. MZ1T]...   363    3e-98 
emb|CAZ88225.1|  putative Flagellar M-ring protein FliF [Thiomona...   362    7e-98 
ref|YP_003613786.1|  flagellar M-ring protein [Enterobacter cloac...   360    3e-97 
ref|ZP_03803237.1|  hypothetical protein PROPEN_01592 [Proteus pe...   360    5e-97 
gb|EFZ60306.1|  flagellar M-ring protein domain protein [Escheric...   353    5e-95 
gb|EFZ71738.1|  flagellar M-ring protein domain protein [Escheric...   349    1e-93 
ref|ZP_08485753.1|  flagellar M-ring protein FliF [Methylomicrobi...   345    1e-92 
ref|NP_777699.1|  flagellar M-ring protein [Buchnera aphidicola s...   345    2e-92 
ref|YP_391708.1|  flagellar M-ring protein FliF [Thiomicrospira c...   340    4e-91 
ref|YP_003262337.1|  flagellar M-ring protein FliF [Halothiobacil...   335    2e-89 
ref|YP_002514037.1|  flagellar FliF M-ring protein [Thioalkalivib...   333    4e-89 
ref|YP_003444876.1|  flagellar M-ring protein FliF [Allochromatiu...   331    2e-88 
dbj|BAA14027.1|  FliF [Shigella boydii]                                330    4e-88 
ref|YP_004480778.1|  flagellar M-ring protein FliF [Marinomonas p...   328    2e-87 
ref|ZP_07653103.1|  flagellar M-ring protein FliF [Methylobacter ...   327    3e-87 
ref|ZP_01167395.1|  flagellar M-ring protein [Oceanospirillum sp....   327    4e-87 
ref|ZP_01075384.1|  flagellar M-ring protein [Marinomonas sp. MED...   326    5e-87 
ref|YP_004513835.1|  flagellar M-ring protein FliF [Methylomonas ...   324    2e-86 
ref|YP_741553.1|  flagellar M-ring protein FliF [Alkalilimnicola ...   324    3e-86 
ref|YP_001342286.1|  flagellar MS-ring protein [Marinomonas sp. M...   317    3e-84 
ref|YP_003812385.1|  Flagellar basal-body M-ring protein [gamma p...   317    6e-84 
ref|YP_001670156.1|  flagellar MS-ring protein [Pseudomonas putid...   316    8e-84 
ref|YP_001982191.1|  flagellar MS-ring protein [Cellvibrio japoni...   315    1e-83 
ref|ZP_05293421.1|  Flagellar M-ring protein fliF [Acidithiobacil...   314    2e-83 
ref|YP_258764.1|  flagellar MS-ring protein [Pseudomonas fluoresc...   314    3e-83 
ref|YP_609319.1|  flagellar MS-ring protein [Pseudomonas entomoph...   313    4e-83 
ref|ZP_01128440.1|  flagellar M-ring protein [Nitrococcus mobilis...   313    4e-83 
gb|ADR59162.1|  FliF [Pseudomonas putida BIRD-1]                       311    2e-82 
ref|ZP_08328599.1|  Flagellar M-ring protein fliF [gamma proteoba...   311    2e-82 
ref|YP_127062.1|  flagellar MS-ring protein [Legionella pneumophi...   311    2e-82 
ref|NP_746483.1|  flagellar MS-ring protein [Pseudomonas putida K...   311    3e-82 
ref|YP_001266839.1|  flagellar MS-ring protein [Pseudomonas putid...   310    4e-82 
ref|YP_001349624.1|  flagellar MS-ring protein [Pseudomonas aerug...   309    9e-82 
ref|YP_124042.1|  flagellar MS-ring protein [Legionella pneumophi...   308    1e-81 
ref|YP_095786.1|  flagellar MS-ring protein [Legionella pneumophi...   308    2e-81 
ref|YP_003619051.1|  flagellar M-ring protein FliF [Legionella pn...   308    3e-81 
ref|NP_249792.1|  flagellar MS-ring protein [Pseudomonas aerugino...   307    3e-81 
ref|YP_003460403.1|  flagellar M-ring protein FliF [Thioalkalivib...   307    3e-81 
ref|ZP_04932792.1|  Flagella M-ring outer membrane protein precur...   307    3e-81 
ref|YP_002441804.1|  flagellar MS-ring protein [Pseudomonas aerug...   306    6e-81 
gb|AAB06801.1|  flagellar MS ring [Pseudomonas aeruginosa]             305    1e-80 
ref|YP_004195656.1|  flagellar M-ring protein FliF [Desulfobulbus...   301    1e-79 
ref|YP_004352677.1|  flagellar MS-ring protein [Pseudomonas brass...   301    2e-79 
ref|YP_527660.1|  flagellar MS-ring protein [Saccharophagus degra...   301    3e-79 
gb|EFS14572.1|  flagellar M-ring domain protein [Shigella flexner...   300    6e-79 
gb|EFW85366.1|  flagellar MS-ring protein [Pseudomonas syringae p...   299    1e-78 
gb|EFW81183.1|  flagellar MS-ring protein [Pseudomonas syringae p...   299    1e-78 
ref|YP_002248115.1|  flagellar M-ring protein FliF [Thermodesulfo...   298    1e-78 
ref|YP_347268.1|  flagellar MS-ring protein [Pseudomonas fluoresc...   298    2e-78 
ref|ZP_06460738.1|  flagellar MS-ring protein [Pseudomonas syring...   298    2e-78 
ref|YP_275541.1|  flagellar MS-ring protein [Pseudomonas syringae...   296    7e-78 
ref|YP_001173082.1|  flagellar MS-ring protein [Pseudomonas stutz...   296    7e-78 
gb|AEA84579.1|  flagellar MS-ring protein [Pseudomonas stutzeri D...   296    9e-78 
ref|ZP_01895617.1|  flagellar M-ring protein FliF [Marinobacter a...   295    2e-77 
ref|YP_001750545.1|  flagellar MS-ring protein [Pseudomonas putid...   293    5e-77 
ref|NP_791781.1|  flagellar M-ring protein FliF [Pseudomonas syri...   293    5e-77 
ref|YP_004051855.1|  flagellar m-ring protein flif [Calditerrivib...   293    6e-77 
gb|EGH10159.1|  flagellar MS-ring protein [Pseudomonas syringae p...   293    6e-77 
gb|EGH97060.1|  flagellar MS-ring protein [Pseudomonas syringae p...   292    9e-77 
gb|ADP98090.1|  flagellar MS-ring protein [Marinobacter adhaerens...   291    2e-76 
gb|EGH72501.1|  flagellar MS-ring protein [Pseudomonas syringae p...   291    3e-76 
ref|YP_236527.1|  flagellar MS-ring protein [Pseudomonas syringae...   291    3e-76 
gb|EGH61480.1|  flagellar MS-ring protein [Pseudomonas syringae p...   291    3e-76 
ref|YP_436296.1|  flagellar MS-ring protein [Hahella chejuensis K...   290    3e-76 
ref|YP_003072887.1|  flagellar MS-ring protein [Teredinibacter tu...   290    4e-76 
ref|ZP_01616672.1|  flagellar M-ring protein FliF [marine gamma p...   290    4e-76 
ref|YP_004473989.1|  flagellar M-ring protein FliF [Pseudomonas f...   290    5e-76 
ref|YP_003495772.1|  flagellar M-ring protein FliF [Deferribacter...   289    8e-76 
ref|YP_002140626.1|  flagellar M-ring mounting plate protein FliF...   288    1e-75 
ref|ZP_01735998.1|  flagellar M-ring protein [Marinobacter sp. EL...   288    2e-75 
gb|EGH54008.1|  flagellar MS-ring protein [Pseudomonas syringae C...   288    2e-75 
ref|ZP_03370869.1|  flagellar MS-ring protein [Salmonella enteric...   287    3e-75 
ref|ZP_01306802.1|  flagellar M-ring protein [Oceanobacter sp. RE...   286    5e-75 
ref|YP_004314290.1|  flagellar M-ring protein FliF [Marinomonas m...   286    6e-75 
ref|ZP_07776768.1|  flagellar M-ring protein FliF [Pseudomonas fl...   286    6e-75 
gb|AAW82147.1|  FliF [Stenotrophomonas maltophilia]                    286    7e-75 
ref|YP_002873972.1|  flagellar MS-ring protein [Pseudomonas fluor...   285    1e-74 
ref|ZP_03383394.1|  flagellar MS-ring protein [Salmonella enteric...   285    2e-74 
ref|YP_001232929.1|  flagellar M-ring protein FliF [Geobacter ura...   284    4e-74 
ref|ZP_01102001.1|  flagellar M-ring protein FliF [Congregibacter...   283    4e-74 
ref|YP_461019.1|  flagellar M-ring protein [Syntrophus aciditroph...   283    5e-74 
ref|YP_003797926.1|  flagellar M-ring protein FliF [Candidatus Ni...   283    6e-74 
ref|YP_001972084.1|  flagellar MS-ring protein [Stenotrophomonas ...   283    7e-74 
ref|YP_004146575.1|  flagellar M-ring protein FliF [Pseudoxanthom...   283    7e-74 
ref|YP_959265.1|  flagellar MS-ring protein [Marinobacter aquaeol...   283    9e-74 
ref|ZP_07262235.1|  flagellar MS-ring protein [Pseudomonas syring...   282    1e-73 
ref|ZP_05129065.1|  flagellar M-ring protein FliF [gamma proteoba...   281    2e-73 
ref|ZP_04587695.1|  flagellar MS-ring protein [Pseudomonas syring...   281    3e-73 
ref|ZP_01312590.1|  flagellar M-ring protein FliF [Desulfuromonas...   279    8e-73 
gb|EBB47446.1|  hypothetical protein GOS_227448 [marine metagenome]    279    9e-73 
ref|YP_004281927.1|  flagellar M-ring protein FliF [Desulfurobact...   279    1e-72 
ref|YP_001188312.1|  flagellar MS-ring protein [Pseudomonas mendo...   278    1e-72 
ref|YP_004200958.1|  flagellar M-ring protein FliF [Geobacter sp....   278    1e-72 
ref|ZP_03656254.1|  flagellar MS-ring protein [Helicobacter canad...   278    1e-72 
emb|CBX29787.1|  hypothetical protein N47_F14820 [uncultured Desu...   278    2e-72 
ref|YP_003023697.1|  flagellar M-ring protein FliF [Geobacter sp....   277    3e-72 
ref|ZP_03342498.1|  flagellar MS-ring protein [Salmonella enteric...   277    5e-72 
ref|NP_951469.1|  flagellar M-ring protein FliF [Geobacter sulfur...   276    8e-72 
ref|ZP_05134806.1|  flagellar M-ring protein FliF [Stenotrophomon...   276    1e-71 
ref|YP_386051.1|  flagellar FliF M-ring protein [Geobacter metall...   275    1e-71 
ref|YP_903076.1|  flagellar M-ring protein FliF [Pelobacter propi...   275    1e-71 
emb|CBE68814.1|  Flagellar basal body M-ring protein [NC10 bacter...   275    2e-71 
ref|YP_002607498.1|  flagellar MS-ring protein [Nautilia profundi...   275    2e-71 
ref|YP_002535964.1|  flagellar M-ring protein FliF [Geobacter sp....   275    2e-71 
ref|YP_001953530.1|  flagellar M-ring protein FliF [Geobacter lov...   274    3e-71 
ref|YP_356611.1|  flagellar M-ring protein FliF [Pelobacter carbi...   273    7e-71 
ref|YP_003375891.1|  flagellar biosynthesis lipoprotein flif [Xan...   273    9e-71 
ref|NP_908101.1|  flagellar MS-ring protein [Wolinella succinogen...   273    9e-71 
ref|ZP_08182496.1|  flagellar basal-body M-ring protein/flagellar...   272    1e-70 
ref|ZP_05109449.1|  flagellar MS-ring protein [Legionella drancou...   272    2e-70 
ref|YP_003517167.1|  flagellar M-ring protein [Helicobacter muste...   271    2e-70 
ref|YP_002028267.1|  flagellar MS-ring protein [Stenotrophomonas ...   270    5e-70 
ref|ZP_08180454.1|  flagellar basal-body M-ring protein/flagellar...   270    6e-70 
ref|ZP_04809613.1|  flagellar basal-body m-ring protein flif [Hel...   270    7e-70 
ref|YP_001002087.1|  flagellar M-ring protein FliF [Halorhodospir...   270    8e-70 
ref|ZP_08423066.1|  flagellar M-ring protein FliF [Desulfovibrio ...   269    1e-69 
ref|YP_363729.1|  flagellar MS-ring protein [Xanthomonas campestr...   268    2e-69 
ref|ZP_01871555.1|  flagellar M-ring protein [Caminibacter mediat...   267    4e-69 
ref|ZP_05638961.1|  flagellar MS-ring protein [Pseudomonas syring...   266    6e-69 
ref|YP_004379632.1|  flagellar MS-ring protein [Pseudomonas mendo...   266    8e-69 
gb|EGH21722.1|  flagellar MS-ring protein [Pseudomonas syringae p...   266    8e-69 
ref|ZP_06729461.1|  flagellar protein [Xanthomonas fuscans subsp....   265    1e-68 
ref|YP_392988.1|  flagellar MS-ring protein [Sulfurimonas denitri...   265    2e-68 
ref|ZP_04583450.1|  flagellar basal-body m-ring protein flif [Hel...   265    2e-68 
ref|NP_642280.1|  flagellar MS-ring protein [Xanthomonas axonopod...   264    3e-68 
ref|ZP_06487662.1|  flagellar MS-ring protein [Xanthomonas campes...   264    3e-68 
ref|ZP_02243239.1|  flagellar MS-ring protein [Xanthomonas oryzae...   263    9e-68 
gb|EDC95811.1|  hypothetical protein GOS_1384600 [marine metagenome]   262    1e-67 
ref|ZP_01287892.1|  Flagellar FliF M-ring protein [delta proteoba...   262    1e-67 
ref|YP_201240.1|  flagellar MS-ring protein [Xanthomonas oryzae p...   262    1e-67 
gb|EBQ48802.1|  hypothetical protein GOS_7743838 [marine metagenome]   262    2e-67 
ref|ZP_06542144.1|  flagellar MS-ring protein [Salmonella enteric...   261    3e-67 
gb|ACX98963.1|  flagellar M-ring protein FliF [Helicobacter pylor...   260    5e-67 
ref|ZP_01291482.1|  Flagellar FliF M-ring protein [delta proteoba...   259    6e-67 
ref|NP_207149.1|  flagellar MS-ring protein [Helicobacter pylori ...   259    9e-67 
ref|YP_003729241.1|  flagellar M-ring protein FliF [Helicobacter ...   258    1e-66 
ref|ZP_03437076.1|  hypothetical protein HPB128_21g129 [Helicobac...   258    2e-66 
ref|YP_002300982.1|  flagellar MS-ring protein [Helicobacter pylo...   258    2e-66 
gb|ADU82797.1|  flagellar MS-ring protein [Helicobacter pylori Li...   258    2e-66 
gb|ADU40720.1|  flagellar M-ring protein FliF [Helicobacter pylor...   258    2e-66 
ref|YP_003928281.1|  flagellar MS-ring protein [Helicobacter pylo...   258    2e-66 
ref|YP_003926647.1|  flagellar MS-ring protein [Helicobacter pylo...   258    2e-66 
ref|ZP_03438790.1|  hypothetical protein HP9810_9g112 [Helicobact...   258    2e-66 
gb|ADI34455.1|  flagellar M-ring protein FliF [Helicobacter pylor...   258    2e-66 
ref|YP_001909843.1|  flagellar MS-ring protein [Helicobacter pylo...   258    3e-66 
gb|ADU81225.1|  flagellar MS-ring protein [Helicobacter pylori Ga...   258    3e-66 
ref|YP_002265960.1|  flagellar basal-body M-ring protein [Helicob...   258    3e-66 
ref|YP_627087.1|  flagellar MS-ring protein [Helicobacter pylori ...   257    3e-66 
ref|YP_003057147.1|  flagellar MS-ring protein [Helicobacter pylo...   257    4e-66 
ref|YP_003197444.1|  flagellar M-ring protein FliF [Desulfohalobi...   257    4e-66 
ref|YP_664742.1|  flagellar MS-ring protein [Helicobacter acinony...   257    4e-66 
ref|NP_223044.1|  flagellar MS-ring protein [Helicobacter pylori ...   257    5e-66 
gb|ADZ51036.1|  Flagellar M-ring protein [Helicobacter pylori 201...   256    5e-66 
dbj|BAJ59475.1|  flagellar MS-ring protein [Helicobacter pylori F57]   256    6e-66 
gb|ACX97551.1|  flagellar basal-body M-ring protein [Helicobacter...   256    6e-66 
ref|ZP_08110414.1|  flagellar M-ring protein FliF [Desulfovibrio ...   256    7e-66 
gb|ADU79570.1|  flagellar MS-ring protein [Helicobacter pylori In...   256    9e-66 
dbj|BAJ58540.1|  flagellar MS-ring protein [Helicobacter pylori F32]   256    9e-66 
ref|YP_003806876.1|  flagellar M-ring protein FliF [Desulfarculus...   255    1e-65 
ref|YP_864202.1|  flagellar M-ring protein FliF [Magnetococcus sp...   255    2e-65 
ref|YP_003505032.1|  flagellar M-ring protein FliF [Denitrovibrio...   254    2e-65 
gb|ADU84370.1|  flagellar MS-ring protein [Helicobacter pylori So...   254    2e-65 
ref|YP_004152053.1|  flagellar M-ring protein FliF [Thermovibrio ...   254    3e-65 
ref|YP_003303291.1|  flagellar M-ring protein FliF [Sulfurospiril...   254    4e-65 
gb|ADN79489.1|  flagellar M-ring protein [Helicobacter pylori 908]     253    6e-65 
ref|YP_009537.1|  flagellar M-ring protein FliF [Desulfovibrio vu...   253    6e-65 
ref|YP_968107.1|  flagellar M-ring protein FliF [Desulfovibrio vu...   253    6e-65 
ref|YP_004072985.1|  Flagellar basal-body M-ring protein FliF [He...   253    6e-65 
ref|YP_002990755.1|  flagellar M-ring protein FliF [Desulfovibrio...   253    7e-65 
ref|NP_637291.1|  flagellar MS-ring protein [Xanthomonas campestr...   253    8e-65 
ref|YP_002604951.1|  FliF [Desulfobacterium autotrophicum HRM2] >...   253    9e-65 
ref|YP_003159520.1|  flagellar M-ring protein FliF [Desulfomicrob...   252    1e-64 
ref|YP_004113483.1|  flagellar M-ring protein FliF [Desulfurispir...   251    2e-64 
ref|YP_002730505.1|  flagellar M-ring protein FliF [Persephonella...   251    3e-64 
ref|YP_004626631.1|  flagellar M-ring protein FliF [Thermodesulfa...   250    4e-64 
ref|ZP_08053893.1|  flagellar MS-ring protein [Helicobacter suis ...   249    1e-63 
ref|YP_004060778.1|  flagellar m-ring protein flif [Sulfuricurvum...   249    1e-63 
ref|YP_821637.1|  flagellar M-ring protein FliF [Candidatus Solib...   247    4e-63 
ref|ZP_02176742.1|  Flagellar M-ring protein [Hydrogenivirga sp. ...   247    5e-63 
ref|YP_066392.1|  flagellar M-ring protein (FliF) [Desulfotalea p...   246    6e-63 
gb|EDI80759.1|  hypothetical protein GOS_371648 [marine metagenome]    244    3e-62 
ref|YP_662607.1|  flagellar MS-ring protein [Pseudoalteromonas at...   244    3e-62 
ref|YP_004121766.1|  flagellar M-ring protein FliF [Desulfovibrio...   244    4e-62 
ref|YP_002523933.1|  flagellar M-ring protein FliF [Thermomicrobi...   243    6e-62 
ref|YP_002955882.1|  flagellar M-ring protein [Desulfovibrio magn...   243    8e-62 
gb|AAZ99737.1|  FliFL [Aeromonas hydrophila]                           243    8e-62 
ref|YP_002297039.1|  flagellar MS-ring protein [Rhodospirillum ce...   243    8e-62 
ref|YP_001140285.1|  flagellar MS-ring protein [Aeromonas salmoni...   243    9e-62 
ref|YP_386849.1|  flagellar M-ring protein FliF [Desulfovibrio de...   242    1e-61 
ref|YP_004433510.1|  flagellar M-ring protein FliF [Glaciecola ag...   242    1e-61 
ref|ZP_05588855.1|  flagellar MS-ring protein [Burkholderia thail...   241    2e-61 
ref|ZP_01044545.1|  flagellar M-ring protein [Nitrobacter sp. Nb-...   241    2e-61 
ref|YP_003892706.1|  flagellar M-ring protein FliF [Sulfurimonas ...   241    3e-61 
ref|YP_576038.1|  flagellar MS-ring protein [Nitrobacter hamburge...   241    3e-61 
ref|ZP_05363021.1|  flagellar M-ring protein FliF [Campylobacter ...   241    4e-61 
gb|EBP70932.1|  hypothetical protein GOS_7867187 [marine metagenome]   240    4e-61 
gb|EES53011.1|  flagellar M-ring protein FliF [Leptospirillum fer...   240    4e-61 
gb|ECX04159.1|  hypothetical protein GOS_2609724 [marine metagenome]   240    6e-61 
ref|ZP_07018045.1|  flagellar M-ring protein FliF [Desulfonatrono...   240    6e-61 
ref|ZP_07334607.1|  flagellar M-ring protein FliF [Desulfovibrio ...   239    7e-61 
ref|YP_001466462.1|  flagellar MS-ring protein [Campylobacter con...   239    7e-61 
gb|EDF52264.1|  hypothetical protein GOS_940516 [marine metagenome]    239    7e-61 
ref|ZP_01452408.1|  flagellar M-ring protein FliF [Mariprofundus ...   239    9e-61 
ref|YP_003318810.1|  flagellar M-ring protein FliF [Sphaerobacter...   239    1e-60 
gb|ECZ20948.1|  hypothetical protein GOS_2223071 [marine metagenome]   239    1e-60 
ref|YP_001356095.1|  flagellar M-ring protein FliF [Nitratiruptor...   239    1e-60 
gb|EBC65649.1|  hypothetical protein GOS_34648 [marine metagenome]     238    1e-60 
ref|YP_002429840.1|  flagellar M-ring protein FliF [Desulfatibaci...   238    2e-60 
ref|ZP_06370492.1|  flagellar M-ring protein FliF [Desulfovibrio ...   238    2e-60 
ref|YP_002575925.1|  flagellar MS-ring protein FliF [Campylobacte...   238    2e-60 
ref|YP_003913602.1|  flagellar M-ring protein FliF [Ferrimonas ba...   238    3e-60 
ref|YP_004607576.1|  flagellar M-ring protein FliF [Helicobacter ...   237    3e-60 
ref|YP_317218.1|  flagellar MS-ring protein [Nitrobacter winograd...   237    4e-60 
ref|YP_002288208.1|  flagellar M-ring protein FliF [Oligotropha c...   237    4e-60 
ref|YP_003290076.1|  flagellar M-ring protein FliF [Rhodothermus ...   236    7e-60 
ref|ZP_07357049.1|  flagellar M-ring protein FliF [Desulfovibrio ...   236    7e-60 
ref|YP_002436697.1|  flagellar M-ring protein FliF [Desulfovibrio...   236    8e-60 
ref|YP_003473414.1|  flagellar M-ring protein FliF [Thermocrinis ...   236    8e-60 
ref|ZP_03609004.1|  flagellar M-ring protein FliF [Campylobacter ...   236    9e-60 
gb|EBB08368.1|  hypothetical protein GOS_291956 [marine metagenome]    236    9e-60 
gb|EBE68729.1|  hypothetical protein GOS_9721837 [marine metagenome]   236    1e-59 
ref|ZP_06373234.1|  flagellar M-ring protein [Campylobacter jejun...   236    1e-59 
ref|ZP_05114389.1|  flagellar M-ring protein FliF [Labrenzia alex...   235    1e-59 
ref|ZP_02178948.1|  Flagellar M-ring protein [Hydrogenivirga sp. ...   234    2e-59 
gb|ECY37401.1|  hypothetical protein GOS_2370940 [marine metagenome]   234    3e-59 
ref|ZP_01100470.1|  flagellar M-ring protein FliF [Campylobacter ...   234    5e-59 
ref|ZP_01067454.1|  flagellar M-ring protein FliF [Campylobacter ...   234    5e-59 
ref|YP_002480151.1|  flagellar M-ring protein FliF [Desulfovibrio...   233    5e-59 
ref|YP_004438427.1|  flagellar M-ring protein FliF [Thermodesulfo...   233    6e-59 
ref|ZP_01223286.1|  flagellar protein [marine gamma proteobacteri...   233    6e-59 
gb|ECV97074.1|  hypothetical protein GOS_2803131 [marine metagenome]   233    6e-59 
ref|ZP_03725341.1|  flagellar M-ring protein FliF [Opitutaceae ba...   233    8e-59 
ref|ZP_05072112.1|  flagellar M-ring protein FliF [Campylobactera...   233    1e-58 
ref|ZP_05083749.1|  flagellar M-ring protein FliF [Pseudovibrio s...   232    1e-58 
ref|YP_595232.1|  flagellar biosynthesis/type III secretory pathw...   232    1e-58 
gb|EDZ39634.1|  Flagellar M-ring protein FliF [Leptospirillum sp....   232    1e-58 
ref|YP_002729313.1|  flagellar M-ring protein FliF [Sulfurihydrog...   231    2e-58 
ref|YP_001481871.1|  flagellar MS-ring protein [Campylobacter jej...   231    2e-58 
ref|YP_178382.1|  flagellar MS-ring protein [Campylobacter jejuni...   231    2e-58 
ref|ZP_01069713.1|  flagellar M-ring protein FliF [Campylobacter ...   231    2e-58 
ref|ZP_05588854.1|  flagellar MS-ring protein [Burkholderia thail...   231    2e-58 
gb|ADO76697.1|  flagellar M-ring protein FliF [Halanaerobium prae...   231    3e-58 
ref|YP_001398635.1|  flagellar MS-ring protein [Campylobacter jej...   231    3e-58 
gb|EAY57819.1|  Flagellar M-ring protein FliF [Leptospirillum rub...   231    3e-58 
ref|YP_003640296.1|  flagellar M-ring protein FliF [Thermincola s...   231    3e-58 
gb|EDB34296.1|  hypothetical protein GOS_1840338 [marine metagenome]   231    4e-58 
ref|ZP_01302009.1|  flagellar M-Ring protein [Sphingomonas sp. SK...   231    4e-58 
gb|EDJ51243.1|  hypothetical protein GOS_1682371 [marine metagenome]   231    4e-58 
ref|YP_001000028.1|  flagellar MS-ring protein [Campylobacter jej...   230    5e-58 
ref|ZP_00367588.1|  flagellar M-ring protein FliF [Campylobacter ...   230    6e-58 
ref|YP_002509433.1|  flagellar M-ring protein FliF [Halothermothr...   230    7e-58 
ref|ZP_06372705.1|  flagellar M-ring protein [Campylobacter jejun...   230    7e-58 
ref|YP_001931794.1|  flagellar M-ring protein FliF [Sulfurihydrog...   229    8e-58 
ref|ZP_01551018.1|  flagellar M-ring protein [Stappia aggregata I...   229    8e-58 
ref|YP_003450369.1|  flagellar M-ring protein [Azospirillum sp. B...   229    8e-58 
ref|YP_003828216.1|  flagellar M-ring protein FliF [Acetohalobium...   229    9e-58 
ref|YP_001817314.1|  flagellar M-ring protein FliF [Opitutus terr...   229    1e-57 
ref|ZP_01132750.1|  flagellar M-ring protein [Pseudoalteromonas t...   229    2e-57 
emb|CAI78781.1|  flagellar biosynthesis/type III secretory pathwa...   228    2e-57 
ref|YP_004069322.1|  flagellar MS-ring protein [Pseudoalteromonas...   228    2e-57 
ref|YP_002314294.1|  flagellar MS-ring protein [Shewanella piezot...   228    2e-57 
ref|ZP_07659477.1|  flagellar M-ring protein FliF [Roseibium sp. ...   228    2e-57 
ref|YP_004340222.1|  flagellar M-ring protein FliF [Hippea mariti...   228    2e-57 
ref|ZP_03357755.1|  flagellar MS-ring protein [Salmonella enteric...   228    3e-57 
ref|YP_001676438.1|  flagellar MS-ring protein [Shewanella halifa...   228    3e-57 
ref|YP_004627104.1|  flagellar M-ring protein FliF [Thermodesulfo...   227    4e-57 
ref|YP_001471818.1|  flagellar MS-ring protein [Shewanella sedimi...   227    5e-57 
ref|ZP_06041059.1|  flagellar M-ring protein FliF [Vibrio mimicus...   226    6e-57 
ref|ZP_01815979.1|  flagellar M-ring protein [Vibrionales bacteri...   226    6e-57 
gb|EDF69352.1|  hypothetical protein GOS_910455 [marine metagenome]    226    7e-57 
ref|ZP_05717538.1|  flagellar M-ring protein [Vibrio mimicus VM57...   226    7e-57 
ref|YP_001499947.1|  flagellar MS-ring protein [Shewanella pealea...   226    1e-56 
ref|NP_970143.1|  flagellar M-ring protein [Bdellovibrio bacterio...   226    1e-56 
ref|YP_001237985.1|  flagellar MS-ring protein [Bradyrhizobium sp...   225    1e-56 
ref|ZP_08389670.1|  flagellar M-ring protein FliF [Sphingomonas s...   225    1e-56 
ref|YP_339316.1|  flagellar MS-ring protein [Pseudoalteromonas ha...   225    1e-56 
gb|AAV85779.1|  FliF [Azospirillum brasilense]                         225    2e-56 
gb|ECW31627.1|  hypothetical protein GOS_2742789 [marine metagenome]   225    2e-56 
ref|ZP_06155871.1|  flagellar M-ring protein FliF [Photobacterium...   225    2e-56 
gb|EDB76326.1|  hypothetical protein GOS_1597378 [marine metagenome]   225    2e-56 
gb|EDF20203.1|  hypothetical protein GOS_996917 [marine metagenome]    225    2e-56 
gb|EDJ54985.1|  hypothetical protein GOS_1675847 [marine metagenome]   225    2e-56 
gb|EDC83731.1|  hypothetical protein GOS_1405957 [marine metagenome]   224    2e-56 
ref|YP_001167839.1|  flagellar M-ring protein FliF [Rhodobacter s...   224    2e-56 
gb|EDJ53438.1|  hypothetical protein GOS_1678580 [marine metagenome]   224    3e-56 
gb|EDJ18778.1|  hypothetical protein GOS_1739746 [marine metagenome]   224    3e-56 
gb|ECV90214.1|  hypothetical protein GOS_2815030 [marine metagenome]   224    3e-56 
gb|EBC03223.1|  hypothetical protein GOS_135430 [marine metagenome]    224    4e-56 
gb|EGH30844.1|  flagellar MS-ring protein [Pseudomonas syringae p...   224    4e-56 
gb|ECX85957.1|  hypothetical protein GOS_2463024 [marine metagenome]   224    4e-56 
ref|ZP_05719596.1|  flagellar M-ring protein [Vibrio mimicus VM60...   223    6e-56 
ref|ZP_01158857.1|  flagellar M-ring protein [Photobacterium sp. ...   223    1e-55 
ref|YP_004068016.1|  flagellar MS-ring protein FliF [Pseudoaltero...   223    1e-55 
ref|YP_003912318.1|  flagellar M-ring protein FliF [Ferrimonas ba...   222    1e-55 
ref|YP_003546529.1|  flagellar M-ring protein FliF [Sphingobium j...   222    1e-55 
ref|YP_779901.1|  flagellar MS-ring protein [Rhodopseudomonas pal...   222    1e-55 
ref|YP_004110470.1|  flagellar M-ring protein FliF [Rhodopseudomo...   222    2e-55 
ref|YP_425636.1|  flagellar MS-ring protein [Rhodospirillum rubru...   222    2e-55 
ref|ZP_01897431.1|  flagellar M-ring protein [Moritella sp. PE36]...   221    2e-55 
gb|AAZ95839.1|  FliF [Aeromonas hydrophila]                            221    3e-55 
ref|YP_855904.1|  flagellar MS-ring protein [Aeromonas hydrophila...   221    3e-55 
ref|YP_001990472.1|  flagellar MS-ring protein [Rhodopseudomonas ...   221    4e-55 
ref|ZP_01233192.1|  flagellar M-ring protein [Vibrio angustum S14...   220    4e-55 
ref|ZP_07744497.1|  flagellar MS-ring protein [Vibrio caribbenthi...   220    5e-55 
gb|EBE91809.1|  hypothetical protein GOS_9683101 [marine metagenome]   220    6e-55 
ref|NP_946615.2|  flagellar MS-ring protein [Rhodopseudomonas pal...   220    6e-55 
ref|ZP_01235735.1|  flagellar M-ring protein [Vibrio angustum S14...   220    6e-55 
ref|YP_002296446.1|  flagellar M-ring protein FliF [Rhodospirillu...   220    6e-55 
ref|YP_003819743.1|  flagellar M-ring protein FliF [Brevundimonas...   220    7e-55 
ref|ZP_08311591.1|  flagellar M-ring protein FliF [Photobacterium...   220    7e-55 
ref|YP_001261790.1|  flagellar M-ring protein FliF [Sphingomonas ...   219    9e-55 
gb|EDA77128.1|  hypothetical protein GOS_1940259 [marine metagenome]   219    1e-54 
gb|EDB26146.1|  hypothetical protein GOS_1854703 [marine metagenome]   219    1e-54 
ref|ZP_01878567.1|  Flagellar FliF M-ring protein [Roseovarius sp...   219    1e-54 
ref|ZP_08519986.1|  flagellar MS-ring protein [Aeromonas caviae A...   218    2e-54 
gb|EDC60854.1|  hypothetical protein GOS_1446270 [marine metagenome]   218    3e-54 
ref|YP_004589894.1|  flagellar basal-body MS-ring and collar prot...   218    3e-54 
gb|ADT87388.1|  flagellar M-ring protein [Vibrio furnissii NCTC 1...   218    3e-54 
emb|CAE26707.1|  putative flagellar M-ring protein [Rhodopseudomo...   218    3e-54 
ref|YP_961868.1|  flagellar MS-ring protein [Shewanella sp. W3-18...   218    3e-54 
ref|YP_001051277.1|  flagellar MS-ring protein [Shewanella baltic...   218    3e-54 
ref|ZP_01869421.1|  flagellar M-ring protein [Vibrio shilonii AK1...   217    4e-54 
ref|ZP_01161924.1|  flagellar M-ring protein [Photobacterium sp. ...   217    4e-54 
ref|YP_155589.1|  flagellar MS-ring protein [Idiomarina loihiensi...   217    4e-54 
ref|YP_001367133.1|  flagellar MS-ring protein [Shewanella baltic...   217    4e-54 
ref|ZP_05897894.1|  flagellar M-ring protein FliF [Selenomonas sp...   217    5e-54 
gb|EDD49902.1|  hypothetical protein GOS_1294156 [marine metagenome]   216    7e-54 
ref|YP_004467978.1|  flagellar MS-ring protein [Alteromonas sp. S...   216    7e-54 
ref|YP_484893.1|  flagellar MS-ring protein [Rhodopseudomonas pal...   216    7e-54 
ref|YP_001052316.1|  flagellar MS-ring protein [Shewanella baltic...   216    7e-54 
ref|YP_001771886.1|  flagellar MS-ring protein [Methylobacterium ...   216    7e-54 
ref|YP_003452982.1|  flagellar M-ring protein [Azospirillum sp. B...   216    8e-54 
ref|YP_001555493.1|  flagellar MS-ring protein [Shewanella baltic...   216    8e-54 
gb|EDC27565.1|  hypothetical protein GOS_1505085 [marine metagenome]   216    8e-54 
gb|ECZ87857.1|  hypothetical protein GOS_2103894 [marine metagenome]   216    9e-54 
ref|ZP_01042102.1|  flagellar M-ring protein [Idiomarina baltica ...   216    1e-53 
ref|YP_004182612.1|  flagellar M-ring protein FliF [Terriglobus s...   216    1e-53 
ref|YP_004554796.1|  flagellar M-ring protein FliF [Sphingobium c...   216    1e-53 
ref|ZP_04716952.1|  flagellar MS-ring protein [Alteromonas macleo...   216    1e-53 
ref|YP_004391751.1|  flagellar M-ring protein FliF [Aeromonas ver...   216    1e-53 
ref|ZP_01258477.1|  flagellar M-ring protein [Vibrio alginolyticu...   216    1e-53 
ref|ZP_02157788.1|  flagellar M-ring protein [Shewanella benthica...   215    1e-53 
ref|ZP_05877705.1|  flagellar M-ring protein FliF [Vibrio furniss...   215    1e-53 
gb|EBB93743.1|  hypothetical protein GOS_151115 [marine metagenome]    215    1e-53 
ref|YP_002310892.1|  flagellar MS-ring protein [Shewanella piezot...   215    2e-53 
ref|ZP_06179529.1|  flagellar M-ring protein [Vibrio alginolyticu...   215    2e-53 
ref|ZP_08567262.1|  flagellar M-ring protein FliF [Shewanella sp....   215    2e-53 
ref|YP_002753381.1|  flagellar M-ring protein FliF [Acidobacteriu...   214    3e-53 
ref|YP_001207777.1|  flagellar MS-ring protein [Bradyrhizobium sp...   214    3e-53 
emb|CAJ73267.1|  similar to flagellar MS ring protein [Candidatus...   214    3e-53 
ref|ZP_05075197.1|  flagellar M-ring protein FliF [Rhodobacterale...   214    3e-53 
ref|ZP_04922221.1|  flagellar M-ring protein FliF [Vibrio sp. Ex2...   214    4e-53 
ref|NP_213805.1|  flagellar M-ring protein [Aquifex aeolicus VF5]...   214    4e-53 
ref|YP_001757700.1|  flagellar MS-ring protein [Methylobacterium ...   214    5e-53 
ref|ZP_04659178.1|  flagellar M-ring protein FliF [Selenomonas fl...   213    5e-53 
ref|ZP_05909569.1|  flagellar M-ring protein FliF [Vibrio parahae...   213    7e-53 
gb|EGF40271.1|  flagellar MS-ring protein [Vibrio parahaemolyticu...   213    8e-53 
ref|YP_003825479.1|  flagellar M-ring protein FliF [Thermosedimin...   213    8e-53 
ref|ZP_08412802.1|  FliF [Rhodobacter sphaeroides WS8N] >sp|Q5315...   213    8e-53 
ref|ZP_00055409.2|  COG1766: Flagellar biosynthesis/type III secr...   213    9e-53 
ref|ZP_01988764.1|  flagellar M-ring protein FliF [Vibrio parahae...   213    1e-52 
ref|ZP_08030473.1|  flagellar M-ring protein FliF [Selenomonas ar...   213    1e-52 
ref|NP_801046.1|  flagellar MS-ring protein [Vibrio parahaemolyti...   213    1e-52 
gb|AAO73593.1|  lateral flagellar FliF-like M-ring protein [Vibri...   213    1e-52 
ref|YP_002525728.1|  Flagellar M-ring protein [Rhodobacter sphaer...   213    1e-52 
ref|YP_002501185.1|  flagellar MS-ring protein [Methylobacterium ...   213    1e-52 
ref|YP_353128.1|  flagellar FliF M-ring protein [Rhodobacter spha...   212    1e-52 
ref|ZP_07025149.1|  flagellar M-ring protein FliF [Afipia sp. 1NL...   212    1e-52 
ref|YP_419866.1|  flagellar MS-ring protein [Magnetospirillum mag...   212    1e-52 
ref|ZP_08570253.1|  flagellar basal-body M-ring protein/flagellar...   212    2e-52 
ref|ZP_07398412.1|  flagellar M-ring protein FliF [Selenomonas sp...   212    2e-52 
ref|YP_001927206.1|  flagellar MS-ring protein [Methylobacterium ...   211    2e-52 
ref|YP_001673673.1|  flagellar MS-ring protein [Shewanella halifa...   211    2e-52 
ref|YP_268244.1|  flagellar MS-ring protein [Colwellia psychreryt...   211    2e-52 
ref|YP_162369.2|  flagellar M-ring protein FliF [Zymomonas mobili...   211    3e-52 
ref|YP_004302872.1|  flagellar M-ring protein [polymorphum gilvum...   211    3e-52 
ref|YP_001408875.1|  flagellar MS-ring protein [Campylobacter cur...   211    3e-52 
ref|ZP_02194035.1|  flagellar M-ring protein [Vibrio sp. AND4] >g...   211    3e-52 
gb|AEH62983.1|  flagellar M-ring protein FliF [Zymomonas mobilis ...   211    3e-52 
gb|EDE01679.1|  hypothetical protein GOS_1204579 [marine metagenome]   211    4e-52 
ref|YP_446715.1|  flagellar M-ring protein FliF [Salinibacter rub...   211    4e-52 
ref|YP_570968.1|  flagellar MS-ring protein [Rhodopseudomonas pal...   211    4e-52 
ref|ZP_07834968.1|  flagellar M-ring protein FliF [Thermaerobacte...   210    5e-52 
gb|EDB26444.1|  hypothetical protein GOS_1854248 [marine metagenome]   210    5e-52 
ref|ZP_07893977.1|  flagellar M-ring protein FliF [Campylobacter ...   210    5e-52 
ref|YP_002120842.1|  flagellar M-ring protein FliF [Hydrogenobacu...   210    5e-52 
ref|YP_003225761.1|  flagellar M-ring protein FliF [Zymomonas mob...   210    5e-52 
ref|ZP_00371957.1|  flagellar M-ring protein FliF [Campylobacter ...   210    5e-52 
ref|ZP_07829529.1|  flagellar M-ring protein FliF [Selenomonas sp...   210    5e-52 
ref|ZP_01612790.1|  flagellar M-ring protein [Alteromonadales bac...   210    5e-52 
ref|ZP_06603158.1|  flagellar M-ring protein FliF [Selenomonas no...   210    5e-52 
ref|ZP_08309018.1|  flagellar M-ring protein FliF [Photobacterium...   210    6e-52 
ref|YP_001141187.1|  flagellar MS-ring protein [Aeromonas salmoni...   210    6e-52 
ref|ZP_01002179.1|  Flagellar FliF M-ring protein [Loktanella ves...   210    6e-52 
gb|ECM17892.1|  hypothetical protein GOS_3935785 [marine metagenome]   210    6e-52 
ref|YP_003572709.1|  flagellar M-ring protein [Salinibacter ruber...   210    6e-52 
ref|ZP_03659149.1|  flagellar MS-ring protein [Helicobacter cinae...   209    8e-52 
ref|ZP_08408996.1|  flagellar M-ring protein FliF [Pseudoalteromo...   209    1e-51 
ref|YP_003551159.1|  flagellar M-ring protein FliF [Candidatus Pu...   209    1e-51 
ref|ZP_07739383.1|  flagellar M-ring protein FliF [Aminomonas pau...   209    1e-51 
gb|EBI49492.1|  hypothetical protein GOS_9083063 [marine metagenome]   209    1e-51 
gb|EBM04700.1|  hypothetical protein GOS_8471899 [marine metagenome]   209    1e-51 
ref|YP_001413455.1|  flagellar M-ring protein FliF [Parvibaculum ...   209    1e-51 
emb|CBW27699.1|  flagellar basal-body M-ring protein [Bacteriovor...   209    1e-51 
gb|EBD33968.1|  hypothetical protein GOS_9945284 [marine metagenome]   209    1e-51 
gb|EBE51362.1|  hypothetical protein GOS_9751058 [marine metagenome]   209    1e-51 
ref|YP_617974.1|  flagellar M-ring protein FliF [Sphingopyxis ala...   209    1e-51 
ref|YP_003702297.1|  flagellar M-ring protein FliF [Syntrophother...   209    2e-51 
ref|ZP_08502694.1|  flagellar M-ring protein FliF [Centipeda peri...   208    2e-51 
ref|YP_004101818.1|  flagellar M-ring protein FliF [Thermaerobact...   208    2e-51 
gb|EBH37040.1|  hypothetical protein GOS_9274249 [marine metagenome]   208    2e-51 
ref|YP_004426320.1|  flagellar MS-ring protein [Alteromonas macle...   208    2e-51 
ref|ZP_01665590.1|  flagellar M-ring protein FliF [Thermosinus ca...   208    3e-51 
dbj|BAC52264.1|  fliF [Bradyrhizobium japonicum USDA 110]              207    5e-51 
gb|AAG29859.1|AF313764_2  flagellar M-Ring protein [Zymomonas mob...   207    5e-51 
ref|YP_590728.1|  flagellar M-ring protein FliF [Candidatus Korib...   207    6e-51 
ref|NP_773639.2|  flagellar MS-ring protein [Bradyrhizobium japon...   206    7e-51 
ref|YP_429632.1|  flagellar MS-ring protein [Moorella thermoaceti...   206    7e-51 
gb|AAD19741.1|  flagellar M-Ring protein [Zymomonas mobilis subsp...   206    7e-51 
ref|ZP_05888209.1|  flagellar M-ring protein FliF [Vibrio coralli...   206    7e-51 
ref|ZP_08139767.1|  flagellar MS-ring protein [Pseudomonas sp. TJ...   206    9e-51 
ref|ZP_01984395.1|  flagellar M-ring protein FliF [Vibrio harveyi...   206    9e-51 
ref|ZP_05876900.1|  flagellar M-ring protein FliF [Vibrio furniss...   206    1e-50 
ref|YP_872600.1|  flagellar M-ring protein FliF [Acidothermus cel...   206    1e-50 
ref|YP_001447108.1|  flagellar MS-ring protein [Vibrio harveyi AT...   206    1e-50 
ref|YP_002129705.1|  flagellar M-ring protein FliF [Phenylobacter...   206    1e-50 
ref|ZP_05944895.1|  flagellar M-ring protein FliF [Vibrio orienta...   206    1e-50 
gb|EBE71357.1|  hypothetical protein GOS_9717554 [marine metagenome]   205    1e-50 
ref|ZP_01219037.1|  flagellar M-ring protein [Photobacterium prof...   205    1e-50 
ref|YP_001759999.1|  flagellar MS-ring protein [Shewanella woodyi...   205    1e-50 
ref|ZP_06174539.1|  flagellar M-ring protein [Vibrio harveyi 1DA3...   205    2e-50 
gb|ADT86584.1|  Flagellar biosynthesis/type III secretory pathway...   205    2e-50 
ref|YP_004264959.1|  flagellar M-ring protein FliF [Syntrophobotu...   204    3e-50 
ref|YP_530830.2|  flagellar MS-ring protein [Rhodopseudomonas pal...   204    4e-50 
ref|ZP_06491619.1|  flagellar MS-ring protein [Xanthomonas campes...   204    4e-50 
ref|YP_002492962.1|  flagellar M-ring protein FliF [Anaeromyxobac...   204    5e-50 
gb|ABD86511.1|  flagellar M-ring protein FliF [Rhodopseudomonas p...   204    5e-50 
ref|YP_001641533.1|  flagellar MS-ring protein [Methylobacterium ...   203    5e-50 
ref|YP_002423164.1|  flagellar MS-ring protein [Methylobacterium ...   203    6e-50 
ref|ZP_01897120.1|  flagellar biosynthesis; basal-body MS(membran...   203    6e-50 
ref|YP_003070515.1|  basal-body MS biosynthesis protein [Methylob...   203    6e-50 
ref|YP_564657.1|  flagellar MS-ring protein [Shewanella denitrifi...   203    7e-50 
ref|ZP_08188226.1|  flagellar basal-body M-ring protein/flagellar...   203    7e-50 
ref|YP_921971.1|  flagellar M-ring protein FliF [Nocardioides sp....   203    7e-50 
ref|ZP_06440428.1|  flagellar M-ring protein FliF [Anaerobaculum ...   203    8e-50 
gb|EBI86782.1|  hypothetical protein GOS_9020450 [marine metagenome]   203    8e-50 
ref|YP_001778279.1|  flagellar M-ring protein FliF [Burkholderia ...   202    9e-50 
gb|ECW94161.1|  hypothetical protein GOS_2628127 [marine metagenome]   202    1e-49 
gb|AEI37495.1|  flagellar M-ring protein FliF [Zymomonas mobilis ...   202    1e-49 
ref|YP_129136.1|  flagellar MS-ring protein [Photobacterium profu...   202    1e-49 
gb|ECD52025.1|  hypothetical protein GOS_3137820 [marine metagenome]   202    2e-49 
ref|ZP_03735052.1|  flagellar M-ring protein FliF [Dethiobacter a...   202    2e-49 
ref|YP_001501223.1|  flagellar MS-ring protein [Shewanella pealea...   201    2e-49 
ref|YP_002965390.1|  flagellar biosynthesis; basal-body MS(membra...   201    2e-49 
ref|ZP_08101609.1|  flagellar MS-ring protein [Vibrio sinaloensis...   201    3e-49 
ref|YP_928172.1|  flagellar MS-ring protein [Shewanella amazonens...   201    3e-49 
ref|ZP_05885379.1|  flagellar M-ring protein FliF [Vibrio coralli...   201    3e-49 
ref|YP_001212639.1|  flagellar MS-ring protein [Pelotomaculum the...   201    3e-49 
gb|EBK01861.1|  hypothetical protein GOS_8801937 [marine metagenome]   201    3e-49 
gb|EBU25713.1|  hypothetical protein GOS_7142195 [marine metagenome]   201    4e-49 
gb|EDA46602.1|  hypothetical protein GOS_1996017 [marine metagenome]   201    4e-49 
ref|ZP_01868146.1|  flagellar M-ring protein [Vibrio shilonii AK1...   200    5e-49 
ref|ZP_05119027.1|  flagellar M-ring protein FliF [Vibrio parahae...   200    5e-49 
ref|ZP_06391387.1|  flagellar M-ring protein FliF [Dethiosulfovib...   200    5e-49 
ref|YP_733418.1|  flagellar MS-ring protein [Shewanella sp. MR-4]...   200    6e-49 
ref|YP_001189896.1|  flagellar MS-ring protein [Pseudomonas mendo...   200    6e-49 
ref|YP_868982.1|  flagellar MS-ring protein [Shewanella sp. ANA-3...   200    6e-49 
ref|YP_464605.1|  flagellar M-ring protein FliF [Anaeromyxobacter...   200    7e-49 
ref|YP_003190225.1|  flagellar MS-ring protein [Desulfotomaculum ...   200    7e-49 
gb|AAY87249.1|  predicted flagellar basal-body M-ring protein [un...   199    9e-49 
ref|YP_001061229.1|  flagellar MS-ring protein [Burkholderia pseu...   199    1e-48 
ref|ZP_02409148.1|  flagellar MS-ring protein [Burkholderia pseud...   199    1e-48 
gb|EBJ62248.1|  hypothetical protein GOS_8867623 [marine metagenome]   199    1e-48 
ref|ZP_05031956.1|  flagellar M-ring protein FliF [Brevundimonas ...   199    1e-48 
ref|YP_962824.1|  flagellar MS-ring protein [Shewanella sp. W3-18...   199    1e-48 
ref|ZP_04967153.1|  flagellar M-ring protein FliF [Burkholderia p...   199    1e-48 
ref|YP_003408110.1|  flagellar M-ring protein FliF [Geodermatophi...   199    2e-48 
gb|ADV55145.1|  flagellar M-ring protein FliF [Shewanella putrefa...   199    2e-48 
ref|NP_718783.1|  flagellar MS-ring protein [Shewanella oneidensi...   198    2e-48 
gb|EBD78207.1|  hypothetical protein GOS_9873084 [marine metagenome]   198    2e-48 
ref|ZP_03698860.1|  flagellar M-ring protein FliF [Lutiella nitro...   198    2e-48 
gb|EDA61975.1|  hypothetical protein GOS_1968212 [marine metagenome]   198    2e-48 
ref|ZP_08098253.1|  flagellar MS-ring protein [Vibrio brasiliensi...   198    2e-48 
gb|ECX85912.1|  hypothetical protein GOS_2463095 [marine metagenome]   198    2e-48 
gb|ECQ90654.1|  hypothetical protein GOS_3805355 [marine metagenome]   198    3e-48 
ref|YP_004565660.1|  FliF [Vibrio anguillarum 775] >gb|AEH32618.1...   198    3e-48 
ref|ZP_05969368.2|  flagellar M-ring protein FliF [Enterobacter c...   198    3e-48 
ref|YP_004497557.1|  flagellar M-ring protein FliF [Desulfotomacu...   198    3e-48 
ref|YP_001917562.1|  flagellar M-ring protein FliF [Natranaerobiu...   197    3e-48 
ref|ZP_02369518.1|  flagellar MS-ring protein [Burkholderia thail...   197    3e-48 
gb|EDB67702.1|  hypothetical protein GOS_1613482 [marine metagenome]   197    3e-48 
ref|YP_003317850.1|  flagellar M-ring protein FliF [Thermanaerovi...   197    3e-48 
ref|ZP_08114822.1|  flagellar M-ring protein FliF [Desulfotomacul...   197    4e-48 
gb|ECL88927.1|  hypothetical protein GOS_5079941 [marine metagenome]   197    4e-48 
ref|ZP_06081034.1|  flagellar M-ring protein FliF [Vibrio sp. RC5...   197    4e-48 
ref|ZP_01866380.1|  flagellar M-ring protein [Vibrio shilonii AK1...   197    5e-48 
ref|YP_001043570.1|  flagellar M-ring protein FliF [Rhodobacter s...   197    5e-48 
gb|EBM11675.1|  hypothetical protein GOS_8460485 [marine metagenome]   197    6e-48 
ref|YP_001717893.1|  flagellar MS-ring protein [Candidatus Desulf...   197    6e-48 
ref|YP_003613785.1|  flagellar M-ring protein FliF [Enterobacter ...   196    7e-48 
ref|YP_004210245.1|  flagellar M-ring protein FliF [Acidobacteriu...   196    8e-48 
ref|YP_891471.1|  flagellar MS-ring protein [Campylobacter fetus ...   196    1e-47 
ref|NP_902669.1|  flagellar MS-ring protein [Chromobacterium viol...   196    1e-47 
gb|ECH85129.1|  hypothetical protein GOS_3625455 [marine metagenome]   196    1e-47 
gb|EGH47363.1|  flagellar MS-ring protein [Pseudomonas syringae p...   196    1e-47 
ref|NP_935274.1|  flagellar MS-ring protein [Vibrio vulnificus YJ...   196    1e-47 
ref|NP_760808.1|  flagellar MS-ring protein [Vibrio vulnificus CM...   196    1e-47 
ref|ZP_06896667.1|  flagellar M-ring protein FliF [Roseomonas cer...   195    2e-47 
ref|YP_003363880.1|  lateral flagellar M-ring protein [Citrobacte...   195    2e-47 
ref|YP_003556181.1|  flagellar M-ring protein FliF [Shewanella vi...   195    2e-47 
ref|YP_944847.1|  flagellar MS-ring protein [Psychromonas ingraha...   195    2e-47 
gb|ECX58588.1|  hypothetical protein GOS_2511862 [marine metagenome]   195    2e-47 
ref|ZP_03803236.1|  hypothetical protein PROPEN_01591 [Proteus pe...   195    2e-47 
ref|ZP_05924170.1|  flagellar M-ring protein FliF [Vibrio sp. RC3...   195    2e-47 
ref|YP_001474798.1|  flagellar MS-ring protein [Shewanella sedimi...   195    2e-47 
gb|EDF16838.1|  hypothetical protein GOS_1002895 [marine metagenome]   194    3e-47 
ref|ZP_06054204.1|  flagellar M-ring protein FliF [Grimontia holl...   194    3e-47 
ref|ZP_02383454.1|  flagellar MS-ring protein [Burkholderia thail...   194    3e-47 
ref|YP_438373.1|  flagellar MS-ring protein [Burkholderia thailan...   194    3e-47 
ref|ZP_05716138.1|  flagellar M-ring protein [Vibrio mimicus VM57...   194    4e-47 
gb|EBQ96558.1|  hypothetical protein GOS_7670854 [marine metagenome]   194    4e-47 
gb|EBB91499.1|  hypothetical protein GOS_154915 [marine metagenome]    194    5e-47 
ref|YP_749873.1|  flagellar MS-ring protein [Shewanella frigidima...   193    6e-47 
ref|YP_435216.1|  flagellar M-ring protein FliF [Hahella chejuens...   193    7e-47 
ref|ZP_06652192.1|  flagellar M-ring protein FliF [Escherichia co...   193    8e-47 
ref|ZP_08346506.1|  flagellar M-ring protein FliF [Escherichia co...   192    1e-46 
ref|NP_231764.1|  flagellar MS-ring protein [Vibrio cholerae O1 b...   192    1e-46 
gb|ECX09645.1|  hypothetical protein GOS_2599917 [marine metagenome]   192    1e-46 
gb|EFZ76783.1|  flagellar M-ring protein FliF [Escherichia coli R...   192    1e-46 
gb|EBP57418.1|  hypothetical protein GOS_7889733 [marine metagenome]   192    1e-46 
ref|ZP_04948384.1|  Flagellar biosynthesis/type III secretory pat...   192    1e-46 
ref|ZP_01676600.1|  flagellar M-ring protein FliF [Vibrio cholera...   192    1e-46 
gb|EBF55223.1|  hypothetical protein GOS_9579099 [marine metagenome]   192    1e-46 
gb|EGB71038.1|  flagellar M-ring protein FliF [Escherichia coli T...   192    1e-46 
ref|ZP_07151050.1|  flagellar M-ring protein FliF [Escherichia co...   192    1e-46 
ref|ZP_04962163.1|  flagellar M-ring protein FliF [Vibrio cholera...   192    2e-46 
ref|YP_001742357.1|  flagellar MS-ring protein [Escherichia coli ...   192    2e-46 
gb|EDC38165.1|  hypothetical protein GOS_1486071 [marine metagenome]   192    2e-46 
gb|EDI88064.1|  hypothetical protein GOS_1792611 [marine metagenome]   191    2e-46 
gb|EBE08518.1|  hypothetical protein GOS_9823512 [marine metagenome]   191    3e-46 
gb|ECP58893.1|  hypothetical protein GOS_5479842 [marine metagenome]   191    4e-46 
ref|ZP_04614343.1|  Flagellar M-ring protein [Yersinia rohdei ATC...   191    4e-46 
ref|YP_001093494.1|  flagellar MS-ring protein [Shewanella loihic...   191    4e-46 
emb|CAH19122.1|  Lateral flagellar M-ring protein (FliF-like) [Es...   191    4e-46 
ref|YP_205235.1|  flagellar MS-ring protein [Vibrio fischeri ES11...   191    4e-46 
gb|ECY60184.1|  hypothetical protein GOS_2331598 [marine metagenome]   191    4e-46 
gb|AEG35041.1|  Flagellar M-ring protein [Escherichia coli NA114]      191    5e-46 
ref|ZP_02195742.1|  flagellar M-ring protein [Vibrio sp. AND4] >g...   190    5e-46 
ref|YP_562333.1|  flagellar MS-ring protein [Shewanella denitrifi...   190    5e-46 
ref|YP_001454439.1|  flagellar MS-ring protein [Citrobacter koser...   190    5e-46 
gb|ECG51293.1|  hypothetical protein GOS_5449228 [marine metagenome]   190    6e-46 
ref|YP_002156678.1|  flagellar M-ring protein FliF [Vibrio fische...   190    6e-46 
ref|ZP_08266712.1|  flagellar M-ring protein FliF [Brevundimonas ...   190    6e-46 
ref|YP_753539.1|  flagellar M-ring protein FliF [Syntrophomonas w...   190    6e-46 
ref|ZP_05294062.1|  Flagellar M-ring protein fliF [Acidithiobacil...   190    6e-46 
ref|YP_003779192.1|  flagellar M-ring protein FliF [Clostridium l...   190    6e-46 
ref|ZP_05876641.1|  flagellar M-ring protein FliF [Vibrio furniss...   190    7e-46 
ref|ZP_06051354.1|  flagellar M-ring protein FliF [Grimontia holl...   190    7e-46 
ref|ZP_07744602.1|  flagellar MS-ring protein [Vibrio caribbenthi...   190    7e-46 
ref|ZP_02999326.1|  flagellar M-ring protein FliF [Escherichia co...   189    9e-46 
gb|EGE66152.1|  flagellar M-ring protein FliF [Escherichia coli S...   189    1e-45 
ref|ZP_05434079.1|  flagellar MS-ring protein [Shigella sp. D9] >...   189    1e-45 
ref|ZP_07594790.1|  flagellar M-ring protein FliF [Escherichia co...   189    1e-45 
ref|ZP_06179818.1|  flagellar M-ring protein [Vibrio alginolyticu...   189    2e-45 
gb|ECC36462.1|  hypothetical protein GOS_4192473 [marine metagenome]   189    2e-45 
gb|EDB05744.1|  hypothetical protein GOS_1889290 [marine metagenome]   188    2e-45 
ref|YP_003227344.1|  putative lateral flagellar basal-body M-ring...   188    2e-45 
ref|YP_003100133.1|  flagellar M-ring protein FliF [Actinosynnema...   188    2e-45 
ref|ZP_01986820.1|  flagellar M-ring protein FliF [Vibrio harveyi...   188    2e-45 
ref|ZP_07246650.1|  flagellar M-ring protein FliF [Escherichia co...   188    2e-45 
ref|YP_001446338.1|  flagellar MS-ring protein [Vibrio harveyi AT...   188    2e-45 
gb|EBT89400.1|  hypothetical protein GOS_7198381 [marine metagenome]   188    3e-45 
ref|ZP_07447513.1|  flagellar MS-ring protein [Escherichia coli N...   188    3e-45 
ref|YP_002411030.1|  flagellar MS-ring protein [Escherichia coli ...   187    3e-45 
ref|ZP_08208560.1|  flagellar M-ring protein FliF [Novosphingobiu...   187    4e-45 
gb|EBA70960.1|  hypothetical protein GOS_355809 [marine metagenome]    187    4e-45 
ref|YP_802615.1|  hypothetical protein BCc_043 [Buchnera aphidico...   187    4e-45 
ref|YP_128279.1|  flagellar MS-ring protein [Photobacterium profu...   187    4e-45 
ref|YP_003594433.1|  cyclic nucleotide-binding protein [Caulobact...   187    5e-45 
ref|YP_004517154.1|  flagellar M-ring protein FliF [Desulfotomacu...   187    6e-45 
emb|CBJ37725.1|  putative Flagellar M-ring protein FliF [Ralstoni...   187    6e-45 
ref|ZP_07097504.1|  flagellar M-ring protein FliF [Escherichia co...   187    6e-45 
ref|ZP_01064462.1|  flagellar M-ring protein [Vibrio sp. MED222] ...   187    6e-45 
gb|EDC04130.1|  hypothetical protein GOS_1546800 [marine metagenome]   187    6e-45 
ref|ZP_04921862.1|  flagellar M-ring protein FliF [Vibrio sp. Ex2...   187    7e-45 
gb|EDG14161.1|  hypothetical protein GOS_833423 [marine metagenome]    186    7e-45 
gb|EFZ56696.1|  flagellar M-ring protein FliF [Escherichia coli L...   186    7e-45 
ref|YP_002416444.1|  flagellar MS-ring protein [Vibrio splendidus...   186    7e-45 
ref|ZP_00991007.1|  flagellar M-ring protein [Vibrio splendidus 1...   186    7e-45 
ref|YP_003232801.1|  putative lateral flagellar basal-body M-ring...   186    7e-45 
ref|YP_003060588.1|  flagellar M-ring protein FliF [Hirschia balt...   186    9e-45 
gb|EDE91794.1|  hypothetical protein GOS_1047561 [marine metagenome]   186    9e-45 
gb|AEH50144.1|  flagellar M-ring protein FliF [Thermotoga thermar...   186    1e-44 
ref|ZP_01258809.1|  flagellar M-ring protein [Vibrio alginolyticu...   186    1e-44 
ref|ZP_04526926.1|  flagellar M-ring protein FliF [Clostridium bu...   186    1e-44 
ref|YP_190863.1|  flagellar MS-ring protein [Gluconobacter oxydan...   186    1e-44 
ref|ZP_01813119.1|  flagellar M-ring protein [Vibrionales bacteri...   186    1e-44 
ref|YP_001361400.1|  flagellar M-ring protein FliF [Kineococcus r...   186    1e-44 
ref|YP_004382530.1|  flagellar MS-ring protein [Pseudomonas mendo...   186    1e-44 
gb|AEA82097.1|  flagellar MS-ring protein [Pseudomonas stutzeri D...   186    1e-44 
ref|YP_001726328.1|  flagellar MS-ring protein [Escherichia coli ...   185    2e-44 
gb|ECX86235.1|  hypothetical protein GOS_2462474 [marine metagenome]   185    2e-44 
ref|ZP_00963769.1|  flagellar FliF M-ring protein [Sulfitobacter ...   185    2e-44 
gb|EGH47422.1|  flagellar MS-ring protein [Pseudomonas syringae p...   185    2e-44 
ref|ZP_05059211.1|  flagellar M-ring protein FliF [Verrucomicrobi...   185    2e-44 
ref|NP_348780.1|  flagellar MS-ring protein [Clostridium acetobut...   185    2e-44 
ref|YP_004535985.1|  flagellar M-ring protein FliF [Novosphingobi...   185    2e-44 
ref|ZP_06033973.1|  flagellar M-ring protein FliF [Vibrio mimicus...   184    3e-44 
gb|ABZ08264.1|  putative Secretory protein of YscJ/FliF family pr...   184    3e-44 
ref|ZP_08372583.1|  flagellar M-ring protein FliF [Escherichia co...   184    3e-44 
gb|EBE65041.1|  hypothetical protein GOS_9728021 [marine metagenome]   184    3e-44 
ref|YP_071839.1|  flagellar MS-ring protein [Yersinia pseudotuber...   184    3e-44 
gb|EGO63145.1|  flagellar M-ring protein FliF [Acetonema longum D...   184    4e-44 
ref|ZP_02995221.1|  hypothetical protein CLOSPO_02343 [Clostridiu...   184    6e-44 
ref|YP_001410344.1|  flagellar M-ring protein FliF [Fervidobacter...   183    6e-44 
gb|ECV71858.1|  hypothetical protein GOS_2847603 [marine metagenome]   183    7e-44 
ref|ZP_06175980.1|  flagellar M-ring protein [Vibrio harveyi 1DA3...   183    7e-44 
ref|NP_860142.1|  flagellar MS-ring protein [Helicobacter hepatic...   183    7e-44 
ref|YP_001399623.1|  flagellar MS-ring protein [Yersinia pseudotu...   183    9e-44 
ref|YP_003239972.1|  flagellar M-ring protein FliF [Ammonifex deg...   183    9e-44 
gb|EBX99139.1|  hypothetical protein GOS_6330771 [marine metagenome]   182    1e-43 
ref|ZP_06354212.1|  flagellar M-ring protein FliF [Citrobacter yo...   182    1e-43 
ref|ZP_06861236.1|  flagellar MS-ring protein [Citromicrobium bat...   182    1e-43 
ref|YP_002334605.1|  flagellar M-ring protein FliF [Thermosipho a...   182    1e-43 
ref|NP_798628.1|  flagellar MS-ring protein [Vibrio parahaemolyti...   182    1e-43 
gb|EDE87010.1|  hypothetical protein GOS_1055682 [marine metagenome]   182    1e-43 
ref|YP_004452198.1|  flagellar M-ring protein FliF [Cellulomonas ...   182    1e-43 
ref|YP_519222.1|  hypothetical protein DSY2989 [Desulfitobacteriu...   182    2e-43 
ref|ZP_02910177.1|  flagellar M-ring protein FliF [Burkholderia a...   182    2e-43 
ref|YP_004353699.1|  flagellar M-ring protein [Pseudomonas brassi...   182    2e-43 
ref|NP_670762.1|  flagellar MS-ring protein [Yersinia pestis KIM ...   182    2e-43 
ref|ZP_01444395.1|  flagellar M-ring protein [Pelagibaca bermuden...   181    2e-43 
ref|YP_001873894.1|  flagellar MS-ring protein [Yersinia pseudotu...   181    3e-43 
ref|ZP_01625746.1|  flagellar M-ring protein [marine gamma proteo...   181    3e-43 
gb|EBF29369.1|  hypothetical protein GOS_9621525 [marine metagenome]   181    4e-43 
ref|YP_002460594.1|  flagellar M-ring protein FliF [Desulfitobact...   181    4e-43 
ref|YP_001568400.1|  flagellar M-ring protein FliF [Petrotoga mob...   180    6e-43 
gb|EBD92162.1|  hypothetical protein GOS_9850572 [marine metagenome]   180    6e-43 
ref|ZP_01862496.1|  flagellar M-ring protein FliF [Erythrobacter ...   180    6e-43 
gb|ECY66657.1|  hypothetical protein GOS_2319685 [marine metagenome]   180    6e-43 
gb|EBJ15583.1|  hypothetical protein GOS_8971405 [marine metagenome]   180    8e-43 
ref|YP_001113743.1|  flagellar MS-ring protein [Desulfotomaculum ...   180    8e-43 
ref|ZP_08328827.1|  Flagellar M-ring protein fliF [gamma proteoba...   179    1e-42 
gb|ADG00358.1|  fliF; flagellar M-ring protein FliF [Clostridium ...   179    1e-42 
gb|ECE26557.1|  hypothetical protein GOS_3649828 [marine metagenome]   179    1e-42 
emb|CBZ04563.1|  flagellar M-ring protein FliF [Clostridium botul...   179    1e-42 
ref|YP_001255161.1|  flagellar MS-ring protein [Clostridium botul...   179    1e-42 
ref|YP_001782279.1|  flagellar MS-ring protein [Clostridium botul...   179    1e-42 
ref|ZP_02615577.1|  flagellar M-ring protein fliF [Clostridium bo...   179    1e-42 
gb|EBW30566.1|  hypothetical protein GOS_6767451 [marine metagenome]   179    1e-42 
ref|YP_003315853.1|  flagellar basal-body M-ring protein/flagella...   179    1e-42 
gb|EBG61817.1|  hypothetical protein GOS_9402902 [marine metagenome]   179    1e-42 
gb|EBT79417.1|  hypothetical protein GOS_7214836 [marine metagenome]   179    1e-42 
ref|ZP_00956642.1|  flagellar M-ring protein [Sulfitobacter sp. E...   179    1e-42 
gb|EBY23911.1|  hypothetical protein GOS_3416921 [marine metagenome]   179    1e-42 
gb|EBF62397.1|  hypothetical protein GOS_9567420 [marine metagenome]   179    1e-42 
gb|ECG51866.1|  hypothetical protein GOS_5423902 [marine metagenome]   179    2e-42 
ref|YP_002805166.1|  flagellar M-ring protein fliF [Clostridium b...   178    2e-42 
gb|EBC88254.1|  hypothetical protein GOS_10020734 [marine metagen...   178    2e-42 
ref|ZP_01215011.1|  flagellar M-ring protein [Psychromonas sp. CN...   178    2e-42 
ref|YP_001680788.1|  flagellar m-ring protein flif, putative [Hel...   178    2e-42 
ref|ZP_08264802.1|  flagellar M-ring protein FliF [Asticcacaulis ...   178    3e-42 
gb|EBQ85127.1|  hypothetical protein GOS_7688179 [marine metagenome]   177    4e-42 
ref|YP_004299490.1|  flagellar M-ring protein [Yersinia enterocol...   177    4e-42 
gb|EDJ25121.1|  hypothetical protein GOS_1728706 [marine metagenome]   177    4e-42 
sp|Q04954.1|FLIF_CAUCR  RecName: Full=Flagellar M-ring protein >g...   177    4e-42 
ref|NP_419721.2|  flagellar MS-ring protein [Caulobacter crescent...   177    5e-42 
ref|ZP_02617933.1|  flagellar M-ring protein FliF [Clostridium bo...   177    5e-42 
ref|ZP_02367490.1|  flagellar MS-ring protein [Burkholderia oklah...   177    5e-42 
ref|YP_001787983.1|  flagellar MS-ring protein [Clostridium botul...   177    5e-42 
ref|YP_004544798.1|  flagellar M-ring protein FliF [Desulfotomacu...   177    6e-42 
gb|EDJ49337.1|  hypothetical protein GOS_1685506 [marine metagenome]   177    6e-42 
ref|ZP_05050102.1|  flagellar M-ring protein FliF [Octadecabacter...   176    7e-42 
ref|YP_076830.1|  flagellar basal-body M-ring protein [Symbiobact...   176    8e-42 
ref|ZP_07395721.1|  flagellar MS-ring protein [Candidatus Regiell...   176    9e-42 
ref|YP_755917.1|  flagellar MS-ring protein [Maricaulis maris MCS...   176    9e-42 
ref|ZP_02360107.1|  flagellar MS-ring protein [Burkholderia oklah...   176    1e-41 
gb|ECA49242.1|  hypothetical protein GOS_4635134 [marine metagenome]   176    1e-41 
ref|ZP_02730987.1|  Flagellar FliF M-ring protein [Gemmata obscur...   176    1e-41 
gb|EBB92948.1|  hypothetical protein GOS_152486 [marine metagenome]    176    1e-41 
ref|YP_001770065.1|  flagellar MS-ring protein [Methylobacterium ...   175    2e-41 
ref|YP_004283750.1|  flagellar M-ring protein FliF [Acidiphilium ...   175    2e-41 
ref|YP_004086431.1|  flagellar m-ring protein flif [Asticcacaulis...   175    2e-41 
ref|YP_001234602.1|  flagellar M-ring protein FliF [Acidiphilium ...   175    2e-41 
ref|YP_003843222.1|  flagellar M-ring protein FliF [Clostridium c...   175    2e-41 
gb|ECL68632.1|  hypothetical protein GOS_5902651 [marine metagenome]   175    2e-41 
gb|ECH73811.1|  hypothetical protein GOS_4069025 [marine metagenome]   175    2e-41 
gb|EBX89963.1|  hypothetical protein GOS_6515492 [marine metagenome]   175    2e-41 
gb|ECN54723.1|  hypothetical protein GOS_5483012 [marine metagenome]   175    2e-41 
ref|ZP_06860264.1|  flagellar M-ring protein FliF [Citromicrobium...   175    2e-41 
ref|YP_004065890.1|  flagellar M-ring protein FliF [Campylobacter...   174    3e-41 
ref|YP_001601921.1|  flagellar MS-ring protein [Gluconacetobacter...   174    3e-41 
ref|YP_003656658.1|  flagellar M-ring protein FliF [Arcobacter ni...   174    3e-41 
gb|ECV76540.1|  hypothetical protein GOS_2839349 [marine metagenome]   174    3e-41 
gb|EBL91637.1|  hypothetical protein GOS_8493229 [marine metagenome]   174    3e-41 
ref|ZP_08211050.1|  flagellar M-ring protein FliF [Thermoanaeroba...   174    4e-41 
ref|YP_002277798.1|  flagellar MS-ring protein [Gluconacetobacter...   174    4e-41 
gb|EBV62105.1|  hypothetical protein GOS_6876717 [marine metagenome]   174    4e-41 
gb|EDF60374.1|  hypothetical protein GOS_926037 [marine metagenome]    174    5e-41 
ref|YP_004158742.1|  flagellar M-ring protein [Bartonella clarrid...   174    5e-41 
gb|EBN70730.1|  hypothetical protein GOS_8201604 [marine metagenome]   174    6e-41 
gb|EBY38003.1|  hypothetical protein GOS_6088726 [marine metagenome]   173    7e-41 
ref|YP_001885041.1|  flagellar MS-ring protein [Clostridium botul...   173    7e-41 
gb|EBQ13222.1|  hypothetical protein GOS_7798122 [marine metagenome]   173    7e-41 
emb|CBX72503.1|  hypothetical protein YEW_GP28340 [Yersinia enter...   173    8e-41 
ref|YP_359840.1|  flagellar MS-ring protein [Carboxydothermus hyd...   173    8e-41 
gb|ABZ06520.1|  putative Secretory protein of YscJ/FliF family pr...   173    8e-41 
ref|ZP_03386014.1|  flagellar MS-ring protein [Salmonella enteric...   173    9e-41 
gb|EBB55462.1|  hypothetical protein GOS_213889 [marine metagenome]    172    1e-40 
ref|YP_001595075.1|  flagellar MS-ring protein [Brucella canis AT...   172    1e-40 
gb|EBJ79138.1|  hypothetical protein GOS_8839127 [marine metagenome]   172    1e-40 
ref|ZP_05839176.1|  flagellar M-ring protein FliF [Brucella suis ...   172    1e-40 
ref|YP_001663315.1|  flagellar M-ring protein FliF [Thermoanaerob...   172    1e-40 
ref|YP_004475098.1|  flagellar M-ring protein FliF [Pseudomonas f...   172    1e-40 
gb|ECL00518.1|  hypothetical protein GOS_5089462 [marine metagenome]   172    1e-40 
ref|ZP_04623342.1|  Flagellar M-ring protein [Yersinia kristensen...   172    2e-40 
ref|NP_228036.1|  flagellar M-ring protein [Thermotoga maritima M...   172    2e-40 
gb|EBM88764.1|  hypothetical protein GOS_8336589 [marine metagenome]   172    2e-40 
ref|ZP_07478000.1|  flagellar M-ring protein FliF [Brucella sp. B...   172    2e-40 
gb|EBU99080.1|  hypothetical protein GOS_6973616 [marine metagenome]   172    2e-40 
ref|ZP_05491625.1|  flagellar M-ring protein FliF [Thermoanaeroba...   172    2e-40 
gb|EBF64790.1|  hypothetical protein GOS_9563533 [marine metagenome]   172    2e-40 
ref|YP_001665247.1|  flagellar M-ring protein FliF [Thermoanaerob...   172    2e-40 
sp|Q8YDM4.3|FLIF_BRUME  RecName: Full=Flagellar M-ring protein         172    2e-40 
gb|ECB41168.1|  hypothetical protein GOS_4466504 [marine metagenome]   171    2e-40 
ref|YP_002534006.1|  Flagellar M-ring protein [Thermotoga neapoli...   171    2e-40 
ref|YP_003161968.1|  flagellar M-ring protein FliF [Jonesia denit...   171    2e-40 
gb|EGE59930.1|  flagellar M-ring protein [Rhizobium etli CNPAF512]     171    2e-40 
ref|ZP_05934101.1|  flagellar M-ring protein FliF [Brucella ceti ...   171    3e-40 
ref|YP_001976890.1|  flagellar M-ring protein [Rhizobium etli CIA...   171    3e-40 
ref|YP_468189.1|  flagellar MS-ring protein [Rhizobium etli CFN 4...   171    3e-40 
ref|ZP_05456229.1|  flagellar MS-ring protein [Brucella ceti M490...   171    3e-40 
gb|ECO37656.1|  hypothetical protein GOS_5708500 [marine metagenome]   171    3e-40 
gb|EBQ94513.1|  hypothetical protein GOS_7673997 [marine metagenome]   171    3e-40 
gb|EDE23848.1|  hypothetical protein GOS_1165595 [marine metagenome]   171    4e-40 
ref|YP_001932956.1|  flagellar MS-ring protein [Brucella abortus ...   171    4e-40 
ref|ZP_01041244.1|  flagellar M-Ring protein [Erythrobacter sp. N...   171    4e-40 
ref|NP_700300.1|  flagellar MS-ring protein [Brucella suis 1330] ...   171    4e-40 
ref|YP_001244299.1|  flagellar M-ring protein FliF [Thermotoga pe...   171    4e-40 
ref|YP_004460672.1|  flagellar M-ring protein FliF [Tepidanaeroba...   171    4e-40 
ref|YP_001258009.1|  flagellar MS-ring protein [Brucella ovis ATC...   170    5e-40 
ref|ZP_05929732.1|  flagellar M-ring protein FliF [Brucella abort...   170    5e-40 
gb|ECD83895.1|  hypothetical protein GOS_5328304 [marine metagenome]   170    5e-40 
ref|ZP_05449992.1|  flagellar MS-ring protein [Brucella neotomae ...   170    5e-40 
ref|ZP_05156928.1|  flagellar MS-ring protein [Brucella abortus b...   170    6e-40 
ref|YP_001372729.1|  flagellar MS-ring protein [Ochrobactrum anth...   170    7e-40 
ref|YP_223817.1|  flagellar MS-ring protein [Brucella abortus bv....   170    8e-40 
emb|CBI82820.1|  Flagellar M-ring protein [Bartonella schoenbuche...   169    1e-39 
ref|YP_002944166.1|  flagellar M-ring protein FliF [Variovorax pa...   169    1e-39 
ref|ZP_04682761.1|  flagellar M-ring protein FliF [Ochrobactrum i...   169    1e-39 
gb|EDC91757.1|  hypothetical protein GOS_1391772 [marine metagenome]   169    1e-39 
ref|YP_001738763.1|  flagellar M-ring protein FliF [Thermotoga sp...   169    2e-39 
ref|YP_002824812.1|  flagellar MS-ring protein [Sinorhizobium fre...   168    2e-39 
ref|NP_782275.1|  flagellar MS-ring protein [Clostridium tetani E...   168    2e-39 
gb|EBG25759.1|  hypothetical protein GOS_9463587 [marine metagenome]   168    2e-39 
ref|YP_001754359.1|  flagellar MS-ring protein [Methylobacterium ...   168    2e-39 
gb|EBG12443.1|  hypothetical protein GOS_9485876 [marine metagenome]   167    3e-39 
gb|EBZ11867.1|  hypothetical protein GOS_3150182 [marine metagenome]   167    4e-39 
gb|EBT78378.1|  hypothetical protein GOS_7216574 [marine metagenome]   167    4e-39 
gb|EDH32626.1|  hypothetical protein GOS_625906 [marine metagenome]    167    5e-39 
ref|YP_989390.1|  flagellar MS-ring protein [Bartonella bacillifo...   167    6e-39 
ref|ZP_05881239.1|  flagellar M-ring protein FliF [Vibrio metschn...   167    6e-39 
ref|ZP_05092240.1|  flagellar M-ring protein FliF [Carboxydibrach...   167    6e-39 
ref|ZP_01226282.1|  putative flagellar M-ring protein [Aurantimon...   167    6e-39 
ref|YP_001523543.1|  flagellar MS-ring protein [Azorhizobium caul...   167    6e-39 
ref|YP_001471516.1|  flagellar M-ring protein FliF [Thermotoga le...   167    7e-39 
ref|YP_877975.1|  flagellar MS-ring protein [Clostridium novyi NT...   167    7e-39 
ref|YP_004277776.1|  flagellar MS-ring protein [Agrobacterium sp....   166    7e-39 
ref|NP_623060.1|  flagellar biosynthesis/type III secretory pathw...   166    8e-39 
ref|YP_002279830.1|  flagellar MS-ring protein [Rhizobium legumin...   166    1e-38 
ref|ZP_08271387.1|  Flagellar M-ring protein fliF [gamma proteoba...   166    1e-38 
gb|EBK25651.1|  hypothetical protein GOS_8762551 [marine metagenome]   166    1e-38 
ref|ZP_04822046.1|  flagellar M-ring protein FliF [Clostridium bo...   165    2e-38 
ref|YP_002489041.1|  flagellar M-ring protein FliF [Arthrobacter ...   165    2e-38 
ref|YP_001490855.1|  flagellar M-ring protein FliF [Arcobacter bu...   165    2e-38 
ref|ZP_04581616.1|  flagellar M-ring protein [Helicobacter bilis ...   165    2e-38 
ref|YP_002974187.1|  flagellar MS-ring protein [Rhizobium legumin...   165    2e-38 
gb|ECA96588.1|  hypothetical protein GOS_6257142 [marine metagenome]   165    2e-38 
gb|AAC01568.1|  M-ring [Brucella abortus]                              165    2e-38 
gb|ECN04224.1|  hypothetical protein GOS_4007540 [marine metagenome]   165    2e-38 
ref|NP_384752.1|  flagellar MS-ring protein [Sinorhizobium melilo...   165    2e-38 
ref|YP_766305.1|  flagellar MS-ring protein [Rhizobium leguminosa...   165    2e-38 
ref|YP_003579613.1|  flagellar M-ring protein FliF [Rhodobacter c...   164    3e-38 
gb|ECF38826.1|  hypothetical protein GOS_6450901 [marine metagenome]   164    3e-38 
ref|YP_001920202.1|  flagellar MS-ring protein [Clostridium botul...   164    5e-38 
ref|YP_001305728.1|  flagellar M-ring protein FliF [Thermosipho m...   164    5e-38 
gb|EBP23135.1|  hypothetical protein GOS_7944677 [marine metagenome]   164    6e-38 
ref|ZP_05111803.1|  truncated flagellar M-ring protein FliF [Legi...   164    6e-38 
ref|ZP_01438710.1|  flagellar M-ring protein [Fulvimarina pelagi ...   163    6e-38 
ref|YP_001325936.1|  flagellar MS-ring protein [Sinorhizobium med...   163    7e-38 
emb|CBI80624.1|  Flagellar M-ring protein [Bartonella sp. 1-1C]        163    7e-38 
gb|ECA49032.1|  hypothetical protein GOS_4643636 [marine metagenome]   163    7e-38 
ref|YP_004305606.1|  flagellar M-ring protein [polymorphum gilvum...   163    9e-38 
ref|ZP_02165087.1|  flagellar M-ring protein [Hoeflea phototrophi...   163    9e-38 
gb|EBE51089.1|  hypothetical protein GOS_9751526 [marine metagenome]   162    1e-37 
gb|EDH89442.1|  hypothetical protein GOS_523236 [marine metagenome]    162    1e-37 
gb|EBJ35045.1|  hypothetical protein GOS_8912919 [marine metagenome]   162    1e-37 
emb|CBI79033.1|  Flagellar M-ring protein FliF [Bartonella sp. AR...   162    1e-37 
ref|ZP_07473980.1|  flagellar M-ring protein FliF [Brucella sp. B...   162    1e-37 
ref|ZP_07891564.1|  flagellar M-ring protein FliF [Arcobacter but...   162    2e-37 
ref|YP_001682640.1|  flagellar MS-ring protein [Caulobacter sp. K...   162    2e-37 
ref|ZP_02622195.1|  flagellar M-ring protein FliF [Clostridium bo...   162    2e-37 
gb|EBZ29530.1|  hypothetical protein GOS_5926932 [marine metagenome]   162    2e-37 
gb|EBI55693.1|  hypothetical protein GOS_9072662 [marine metagenome]   161    3e-37 
gb|EBI74778.1|  hypothetical protein GOS_9040333 [marine metagenome]   161    3e-37 
ref|YP_061692.1|  flagellar M-ring protein [Leifsonia xyli subsp....   161    3e-37 
ref|NP_104152.1|  flagellar MS-ring protein [Mesorhizobium loti M...   161    3e-37 
ref|YP_004610575.1|  flagellar M-ring protein FliF [Mesorhizobium...   161    3e-37 
gb|AEH77565.1|  flagellar MS-ring protein [Sinorhizobium meliloti...   161    4e-37 
ref|YP_003108779.1|  flagellar M-ring protein FliF [Acidimicrobiu...   161    4e-37 
gb|EDH30542.1|  hypothetical protein GOS_629582 [marine metagenome]    160    4e-37 
gb|ECM52418.1|  hypothetical protein GOS_6083815 [marine metagenome]   160    5e-37 
ref|YP_002759843.1|  flagellar M-ring protein [Gemmatimonas auran...   160    5e-37 
emb|CAA11947.1|  flagellar basal-body MS-ring protein [Sinorhizob...   160    6e-37 
ref|ZP_05390670.1|  flagellar M-ring protein FliF [Clostridium ca...   160    7e-37 
ref|YP_004062349.1|  flagellar MS-ring protein [Candidatus Liberi...   160    7e-37 
gb|EBT53671.1|  hypothetical protein GOS_7257529 [marine metagenome]   160    9e-37 
ref|YP_001833750.1|  flagellar MS-ring protein [Beijerinckia indi...   159    1e-36 
ref|ZP_01156099.1|  putative flagellar M-ring protein [Oceanicola...   159    1e-36 
ref|YP_002550953.1|  flagellar MS-ring protein [Agrobacterium vit...   159    2e-36 
ref|YP_001923321.1|  flagellar MS-ring protein [Methylobacterium ...   158    2e-36 
ref|YP_001044846.1|  flagellar MS-ring protein [Rhodobacter sphae...   158    2e-36 
ref|ZP_00952910.1|  flagellar M-ring protein [Oceanicaulis alexan...   158    2e-36 
ref|YP_001394543.1|  flagellar MS-ring protein [Clostridium kluyv...   158    2e-36 
gb|ECT56241.1|  hypothetical protein GOS_5475119 [marine metagenome]   158    2e-36 
emb|CBI77559.1|  Flagellar M-ring protein [Bartonella rochalimae ...   158    2e-36 
ref|YP_003477061.1|  flagellar M-ring protein FliF [Thermoanaerob...   158    3e-36 
ref|YP_003677012.1|  flagellar M-ring protein FliF [Thermoanaerob...   157    4e-36 
gb|EBC22604.1|  hypothetical protein GOS_104421 [marine metagenome]    157    5e-36 
ref|YP_004141148.1|  flagellar M-ring protein FliF [Mesorhizobium...   157    5e-36 
gb|EDI22864.1|  hypothetical protein GOS_467210 [marine metagenome]    157    5e-36 
gb|EBK84876.1|  hypothetical protein GOS_8665173 [marine metagenome]   157    6e-36 
ref|ZP_07453761.1|  flagellar M-ring protein FliF [Eubacterium yu...   157    7e-36 
ref|NP_773504.1|  flagellar MS-ring protein [Bradyrhizobium japon...   157    7e-36 
ref|YP_002527073.1|  flagellar MS-ring protein [Rhodobacter sphae...   157    7e-36 
ref|YP_004471037.1|  flagellar M-ring protein FliF [Thermoanaerob...   156    8e-36 
ref|YP_004599547.1|  flagellar M-ring protein FliF [Cellvibrio gi...   156    9e-36 
gb|EBM25035.1|  hypothetical protein GOS_8439329 [marine metagenome]   156    1e-35 
ref|YP_003065108.1|  flagellar MS-ring protein [Candidatus Liberi...   156    1e-35 
gb|ECA93674.1|  hypothetical protein GOS_6376816 [marine metagenome]   156    1e-35 
ref|ZP_02151690.1|  flagellar M-ring protein FliF [Oceanibulbus i...   155    2e-35 
gb|EBZ88873.1|  hypothetical protein GOS_3561768 [marine metagenome]   155    2e-35 
ref|YP_003391849.1|  flagellar M-ring protein FliF [Conexibacter ...   155    2e-35 
ref|YP_003066311.1|  flagellar M-ring protein FliF [Methylobacter...   154    3e-35 
gb|ECQ53886.1|  hypothetical protein GOS_5254219 [marine metagenome]   154    3e-35 
gb|EBM04931.1|  hypothetical protein GOS_8471489 [marine metagenome]   154    3e-35 
ref|YP_004395806.1|  flagellar M-ring protein FliF [Clostridium b...   154    3e-35 
gb|EDI03591.1|  hypothetical protein GOS_499857 [marine metagenome]    154    4e-35 
ref|ZP_08414111.1|  FliF2 [Rhodobacter sphaeroides WS8N] >gb|EGJ2...   154    4e-35 
ref|YP_002419490.1|  flagellar MS-ring protein [Methylobacterium ...   154    5e-35 
ref|YP_001638114.1|  flagellar MS-ring protein [Methylobacterium ...   154    5e-35 
ref|YP_001311334.1|  flagellar MS-ring protein [Clostridium beije...   154    5e-35 
ref|YP_002961674.1|  flagellar M-ring protein FliF [methylobacter...   154    5e-35 
gb|EDC73895.1|  hypothetical protein GOS_1423050 [marine metagenome]   154    6e-35 
gb|EBP79120.1|  hypothetical protein GOS_7854059 [marine metagenome]   153    8e-35 
ref|NP_353552.1|  flagellar MS-ring protein [Agrobacterium tumefa...   153    9e-35 
ref|ZP_08528626.1|  flagellar MS-ring protein [Agrobacterium sp. ...   152    1e-34 
ref|YP_916432.1|  flagellar MS-ring protein [Paracoccus denitrifi...   152    1e-34 
ref|YP_001168937.1|  flagellar MS-ring protein [Rhodobacter sphae...   152    1e-34 
gb|ECH31500.1|  hypothetical protein GOS_5755415 [marine metagenome]   152    1e-34 
ref|YP_354394.3|  flagellar MS-ring protein [Rhodobacter sphaeroi...   152    1e-34 
gb|EBD94148.1|  hypothetical protein GOS_9847170 [marine metagenome]   152    1e-34 
ref|ZP_05117118.1|  flagellar M-ring protein FliF [Labrenzia alex...   152    2e-34 
gb|EBG25587.1|  hypothetical protein GOS_9463940 [marine metagenome]   152    2e-34 
gb|ECU68795.1|  hypothetical protein GOS_3384245 [marine metagenome]   152    2e-34 
gb|EBV20775.1|  hypothetical protein GOS_6940242 [marine metagenome]   152    2e-34 
gb|EBP19684.1|  hypothetical protein GOS_7950652 [marine metagenome]   151    3e-34 
ref|ZP_01547377.1|  flagellar M-ring protein [Stappia aggregata I...   150    4e-34 
gb|EBN84908.1|  hypothetical protein GOS_8178151 [marine metagenome]   150    5e-34 
gb|EBZ64732.1|  hypothetical protein GOS_4487957 [marine metagenome]   150    5e-34 
gb|ECO77836.1|  hypothetical protein GOS_4103141 [marine metagenome]   150    5e-34 
gb|EBU33265.1|  hypothetical protein GOS_7130587 [marine metagenome]   150    5e-34 
gb|EBL30694.1|  hypothetical protein GOS_8592932 [marine metagenome]   150    6e-34 
ref|YP_003757209.1|  flagellar M-ring protein FliF [Hyphomicrobiu...   150    6e-34 
gb|ECJ82121.1|  hypothetical protein GOS_6321725 [marine metagenome]   150    6e-34 
ref|YP_002246683.1|  flagellar M-ring protein FliF [Coprothermoba...   150    6e-34 
ref|ZP_05783367.1|  flagellar M-ring protein FliF [Citreicella sp...   150    7e-34 
gb|ECQ48896.1|  hypothetical protein GOS_5454022 [marine metagenome]   150    8e-34 
ref|YP_004012885.1|  flagellar M-ring protein FliF [Rhodomicrobiu...   150    8e-34 
ref|YP_672855.1|  flagellar MS-ring protein [Mesorhizobium sp. BN...   149    1e-33 
gb|ECO30945.1|  hypothetical protein GOS_5982396 [marine metagenome]   149    1e-33 
gb|EBQ12938.1|  hypothetical protein GOS_7798608 [marine metagenome]   149    1e-33 
gb|ECD83941.1|  hypothetical protein GOS_5326804 [marine metagenome]   149    1e-33 
gb|EDH37463.1|  hypothetical protein GOS_617302 [marine metagenome]    149    2e-33 
gb|ECL11688.1|  hypothetical protein GOS_4653882 [marine metagenome]   149    2e-33 
gb|ECQ37670.1|  hypothetical protein GOS_5899892 [marine metagenome]   148    2e-33 
gb|ECC46606.1|  hypothetical protein GOS_3800470 [marine metagenome]   148    2e-33 
ref|ZP_04433451.1|  flagellar M-ring protein FliF [Bacillus coagu...   148    3e-33 
gb|ECD52026.1|  hypothetical protein GOS_3137821 [marine metagenome]   148    3e-33 
ref|ZP_06889889.1|  flagellar M-ring protein FliF [Methylosinus t...   148    3e-33 
ref|ZP_06894564.1|  flagellar M-ring protein FliF [Roseomonas cer...   148    3e-33 
ref|ZP_01880082.1|  flagellar M-ring protein FliF [Roseovarius sp...   148    3e-33 
ref|ZP_05131478.1|  flagellar MS-ring protein [Clostridium sp. 7_...   148    3e-33 
ref|XP_002339855.1|  predicted protein [Populus trichocarpa] >gb|...   147    4e-33 
gb|EBG39991.1|  hypothetical protein GOS_9439530 [marine metagenome]   147    4e-33 
ref|YP_003852053.1|  flagellar M-ring protein FliF [Thermoanaerob...   147    4e-33 
ref|YP_002543379.1|  flagellar M-ring protein [Agrobacterium radi...   147    4e-33 
gb|EBY80349.1|  hypothetical protein GOS_4370221 [marine metagenome]   147    5e-33 
ref|XP_002536098.1|  Flagellar M-ring protein, putative [Ricinus ...   147    5e-33 
ref|ZP_04863387.1|  flagellar M-ring protein FliF [Clostridium bo...   147    6e-33 
ref|YP_003589351.1|  flagellar M-ring protein FliF [Bacillus tusc...   147    7e-33 
ref|YP_003936766.1|  flagellar m-ring protein flif [Clostridium s...   147    7e-33 
gb|EDJ25106.1|  hypothetical protein GOS_1728727 [marine metagenome]   146    9e-33 
ref|YP_003854770.1|  flagellar M-ring protein FliF [Parvularcula ...   146    1e-32 
ref|ZP_08074709.1|  flagellar M-ring protein FliF [Methylocystis ...   146    1e-32 
ref|YP_079014.1|  flagellar MS-ring protein [Bacillus licheniform...   146    1e-32 
gb|ECQ59618.1|  hypothetical protein GOS_5029000 [marine metagenome]   146    1e-32 
gb|ECN49863.1|  hypothetical protein GOS_5684538 [marine metagenome]   146    1e-32 
gb|ECE98619.1|  hypothetical protein GOS_4495418 [marine metagenome]   145    1e-32 
gb|EBY42725.1|  hypothetical protein GOS_5891912 [marine metagenome]   145    2e-32 
gb|EDH35417.1|  hypothetical protein GOS_621022 [marine metagenome]    145    2e-32 
gb|EDE53244.1|  hypothetical protein GOS_1114476 [marine metagenome]   145    2e-32 
ref|ZP_07636955.1|  flagellar M-ring protein FliF [Mobiluncus mul...   145    2e-32 
gb|ECG98035.1|  hypothetical protein GOS_3598681 [marine metagenome]   145    3e-32 
gb|ECQ06670.1|  hypothetical protein GOS_3612396 [marine metagenome]   144    3e-32 
ref|YP_001534598.1|  flagellar MS-ring protein [Dinoroseobacter s...   144    3e-32 
ref|ZP_07374438.1|  flagellar M-ring protein FliF [Ahrensia sp. R...   144    3e-32 
gb|EBF10902.1|  hypothetical protein GOS_9651391 [marine metagenome]   144    5e-32 
ref|ZP_08056210.1|  flagellar MS-ring protein-like protein [Paeni...   144    5e-32 
gb|ECF38366.1|  hypothetical protein GOS_6470007 [marine metagenome]   144    6e-32 
gb|EBU32942.1|  hypothetical protein GOS_7131067 [marine metagenome]   143    7e-32 
ref|ZP_02330411.1|  flagellar MS-ring protein [Paenibacillus larv...   143    7e-32 
ref|ZP_05086722.1|  flagellar M-ring protein FliF [Pseudovibrio s...   143    9e-32 
ref|ZP_01157139.1|  putative flagellar M-ring protein [Oceanicola...   143    1e-31 
ref|ZP_05270384.1|  flagellar MS-ring protein [Clostridium diffic...   143    1e-31 
gb|ECN88589.1|  hypothetical protein GOS_4159779 [marine metagenome]   143    1e-31 
ref|YP_530988.1|  flagellar MS-ring protein [Rhodopseudomonas pal...   143    1e-31 
gb|ECU06096.1|  hypothetical protein GOS_3496606 [marine metagenome]   142    1e-31 
gb|ECF54985.1|  hypothetical protein GOS_5806177 [marine metagenome]   142    1e-31 
ref|NP_389503.1|  flagellar MS-ring protein [Bacillus subtilis su...   142    1e-31 
gb|ECQ05909.1|  hypothetical protein GOS_3642340 [marine metagenome]   142    2e-31 
ref|ZP_02184088.1|  flagellar M-ring protein fliF [Carnobacterium...   142    2e-31 
ref|YP_165469.1|  flagellar MS-ring protein [Ruegeria pomeroyi DS...   142    2e-31 
ref|ZP_03529001.1|  flagellar MS-ring protein [Rhizobium etli CIA...   142    2e-31 
ref|ZP_05328392.1|  flagellar MS-ring protein [Clostridium diffic...   141    3e-31 
ref|ZP_01749867.1|  flagellar M-ring protein FliF, putative [Rose...   141    3e-31 
ref|ZP_06098559.1|  flagellar M-ring protein FliF [Brucella sp. 8...   141    3e-31 
gb|ECS05850.1|  hypothetical protein GOS_6221326 [marine metagenome]   141    3e-31 
gb|ECM14467.1|  hypothetical protein GOS_4068527 [marine metagenome]   141    3e-31 
ref|ZP_05349444.1|  flagellar MS-ring protein [Clostridium diffic...   141    3e-31 
ref|YP_001086716.1|  flagellar MS-ring protein [Clostridium diffi...   141    4e-31 
ref|YP_004207674.1|  flagellar MS-ring protein [Bacillus subtilis...   141    4e-31 
ref|ZP_03591343.1|  flagellar MS-ring protein [Bacillus subtilis ...   141    4e-31 
gb|EBB56747.1|  hypothetical protein GOS_211647 [marine metagenome]    140    4e-31 
gb|ECC26787.1|  hypothetical protein GOS_4560288 [marine metagenome]   140    5e-31 
ref|ZP_01116018.1|  flagellar M-ring protein FliF [Reinekea sp. M...   140    5e-31 
ref|ZP_05650942.1|  flagellar M-ring protein fliF [Enterococcus g...   140    6e-31 
gb|EBS26517.1|  hypothetical protein GOS_7464923 [marine metagenome]   140    6e-31 
gb|ECP29758.1|  hypothetical protein GOS_5535509 [marine metagenome]   140    7e-31 
ref|ZP_06499878.1|  flagellar MS-ring protein [Pseudomonas syring...   140    7e-31 
ref|YP_004568576.1|  flagellar M-ring protein FliF [Bacillus coag...   140    7e-31 
gb|EBB46189.1|  hypothetical protein GOS_229633 [marine metagenome]    140    8e-31 
ref|YP_314846.1|  flagellar biosynthesis/type III secretory pathw...   140    8e-31 
ref|ZP_06183262.1|  flagellar M-ring protein FliF [Mobiluncus mul...   140    8e-31 
ref|ZP_03994848.1|  flagellar M-ring protein FliF [Mobiluncus mul...   139    9e-31 
ref|YP_002360380.1|  flagellar MS-ring protein [Methylocella silv...   139    1e-30 
gb|ECX39322.1|  hypothetical protein GOS_2546398 [marine metagenome]   139    1e-30 
gb|EBZ70749.1|  hypothetical protein GOS_4266687 [marine metagenome]   139    1e-30 
ref|ZP_05655644.1|  flagellar M-ring protein fliF [Enterococcus c...   139    1e-30 
ref|ZP_05646031.1|  flagellar M-ring protein fliF [Enterococcus c...   139    2e-30 
ref|YP_001421198.1|  flagellar MS-ring protein [Bacillus amyloliq...   139    2e-30 
gb|EBP81510.1|  hypothetical protein GOS_7850178 [marine metagenome]   139    2e-30 
ref|YP_680680.1|  flagellar MS-ring protein [Roseobacter denitrif...   139    2e-30 
gb|EGJ00503.1|  flagellar M-ring protein domain protein [Shigella...   139    2e-30 
gb|EBD45785.1|  hypothetical protein GOS_9926642 [marine metagenome]   139    2e-30 
gb|EBR09401.1|  hypothetical protein GOS_7653438 [marine metagenome]   139    2e-30 
ref|ZP_07910399.1|  flagellar M-ring protein [Mobiluncus curtisii...   139    2e-30 
gb|ECU57413.1|  hypothetical protein GOS_3826134 [marine metagenome]   138    2e-30 
gb|EDF51734.1|  hypothetical protein GOS_941457 [marine metagenome]    138    2e-30 
ref|YP_003718677.1|  flagellar M-ring protein FliF [Mobiluncus cu...   138    2e-30 
ref|ZP_05343442.1|  flagellar M-ring protein FliF [Thalassiobium ...   138    3e-30 
ref|ZP_07907483.1|  flagellar M-ring protein [Mobiluncus curtisii...   138    3e-30 
gb|ECF84834.1|  hypothetical protein GOS_4599478 [marine metagenome]   138    3e-30 
ref|YP_780098.1|  flagellar MS-ring protein [Rhodopseudomonas pal...   137    4e-30 
ref|ZP_00209445.1|  COG1766: Flagellar biosynthesis/type III secr...   137    4e-30 
ref|ZP_06715199.1|  flagellar M-ring protein [Edwardsiella tarda ...   137    4e-30 
ref|ZP_01745848.1|  flagellar M-ring protein FliF [Sagittula stel...   137    5e-30 
ref|ZP_08081630.1|  putative flagellar M-ring protein fliF [Lacto...   137    5e-30 
ref|ZP_02139932.1|  flagellar M-ring protein FliF, putative [Rose...   137    6e-30 
ref|ZP_08563344.1|  flagellar M-ring protein fliF [Lactobacillus ...   137    6e-30 
gb|EBW68970.1|  hypothetical protein GOS_6707032 [marine metagenome]   137    7e-30 
gb|EBC11092.1|  hypothetical protein GOS_122494 [marine metagenome]    137    7e-30 
ref|ZP_05953139.1|  flagellar MS-ring protein [Brucella pinnipedi...   136    1e-29 
ref|YP_003920288.1|  flagellar basal-body M-ring protein [Bacillu...   136    1e-29 
gb|EBZ97765.1|  hypothetical protein GOS_3218257 [marine metagenome]   136    1e-29 
ref|ZP_05930865.1|  flagellar M-ring protein FliF [Brucella ceti ...   136    1e-29 
ref|ZP_04511447.1|  Flagellar M-ring protein fliF [Yersinia pesti...   136    1e-29 
ref|ZP_05168316.1|  flagellar MS-ring protein [Brucella pinnipedi...   136    1e-29 
gb|EBF53644.1|  hypothetical protein GOS_9581591 [marine metagenome]   136    1e-29 
gb|ECJ04141.1|  hypothetical protein GOS_5895324 [marine metagenome]   135    2e-29 
gb|EBN43881.1|  hypothetical protein GOS_8246627 [marine metagenome]   135    2e-29 
gb|EBB16671.1|  hypothetical protein GOS_278665 [marine metagenome]    135    2e-29 
ref|ZP_06873310.1|  flagellar MS-ring protein [Bacillus subtilis ...   135    2e-29 
ref|ZP_08144198.1|  flagellar M-ring protein fliF [Enterococcus c...   135    3e-29 
ref|YP_003973065.1|  flagellar MS-ring protein [Bacillus atrophae...   135    3e-29 
ref|YP_003964809.1|  flagellar M-ring protein FliF, [Ketogulonici...   134    3e-29 
gb|ECR32601.1|  hypothetical protein GOS_5632917 [marine metagenome]   134    3e-29 
ref|ZP_05122077.1|  flagellar M-ring protein FliF [Rhodobacterace...   134    4e-29 
ref|YP_512122.1|  flagellar MS-ring protein [Jannaschia sp. CCS1]...   134    5e-29 
ref|YP_001125193.1|  flagellar MS-ring protein [Geobacillus therm...   134    6e-29 
gb|AEB23977.1|  flagellar MS-ring protein [Bacillus amyloliquefac...   134    6e-29 
gb|EBZ23617.1|  hypothetical protein GOS_6165048 [marine metagenome]   134    7e-29 
ref|YP_758973.1|  flagellar MS-ring protein [Hyphomonas neptunium...   133    7e-29 
gb|EBM93424.1|  hypothetical protein GOS_8328830 [marine metagenome]   133    8e-29 
gb|ECQ15595.1|  hypothetical protein GOS_3278583 [marine metagenome]   133    8e-29 
ref|ZP_05741441.1|  flagellar MS-ring protein [Silicibacter sp. T...   133    9e-29 
ref|ZP_08510159.1|  flagellar M-ring protein FliF [Paenibacillus ...   133    1e-28 
gb|AEB63320.1|  flagellar basal-body M-ring protein [Bacillus amy...   132    1e-28 
ref|ZP_03146341.1|  flagellar M-ring protein FliF [Geobacillus sp...   132    1e-28 
gb|ECD95355.1|  hypothetical protein GOS_4871049 [marine metagenome]   132    1e-28 
gb|EBY88917.1|  hypothetical protein GOS_4042823 [marine metagenome]   132    2e-28 
ref|YP_002316087.1|  flagellar MS-ring protein [Anoxybacillus fla...   132    2e-28 
gb|ECB83946.1|  hypothetical protein GOS_6288348 [marine metagenome]   132    2e-28 
gb|EBG14855.1|  hypothetical protein GOS_9481908 [marine metagenome]   132    2e-28 
gb|ECG54834.1|  hypothetical protein GOS_5303973 [marine metagenome]   132    2e-28 
gb|ECH09119.1|  hypothetical protein GOS_3173487 [marine metagenome]   132    2e-28 
ref|YP_003989995.1|  flagellar M-ring protein FliF [Geobacillus s...   132    2e-28 
ref|YP_004375670.1|  flagellar M-ring protein [Carnobacterium sp....   132    2e-28 
ref|ZP_08533358.1|  flagellar M-ring protein FliF [Caldalkalibaci...   131    3e-28 
gb|ECU72068.1|  hypothetical protein GOS_3263075 [marine metagenome]   131    3e-28 
gb|EBN60753.1|  hypothetical protein GOS_8218352 [marine metagenome]   131    3e-28 
ref|ZP_01754269.1|  flagellar M-ring protein FliF [Roseobacter sp...   131    3e-28 
gb|ECM60635.1|  hypothetical protein GOS_5753544 [marine metagenome]   131    4e-28 
ref|ZP_01443283.1|  flagellar M-ring protein FliF [Pelagibaca ber...   131    4e-28 
gb|ECN96195.1|  hypothetical protein GOS_3871099 [marine metagenome]   131    4e-28 
ref|YP_001486762.1|  flagellar MS-ring protein [Bacillus pumilus ...   130    5e-28 
ref|YP_001513019.1|  flagellar M-ring protein FliF [Alkaliphilus ...   130    6e-28 
gb|EDH88932.1|  hypothetical protein GOS_524108 [marine metagenome]    130    8e-28 
ref|ZP_08003723.1|  flagellar M-ring protein [Bacillus sp. 2_A_57...   130    8e-28 
gb|EBH93637.1|  hypothetical protein GOS_9176951 [marine metagenome]   130    8e-28 
ref|YP_002949237.1|  flagellar MS-ring protein [Geobacillus sp. W...   129    1e-27 
gb|EBF44695.1|  hypothetical protein GOS_9596190 [marine metagenome]   129    1e-27 
gb|ECT70935.1|  hypothetical protein GOS_4879731 [marine metagenome]   129    1e-27 
gb|EBW13192.1|  hypothetical protein GOS_6795485 [marine metagenome]   129    1e-27 
gb|EBO46447.1|  hypothetical protein GOS_8075968 [marine metagenome]   129    1e-27 
gb|EBQ93922.1|  hypothetical protein GOS_7674966 [marine metagenome]   128    2e-27 
gb|ECN62191.1|  hypothetical protein GOS_5181132 [marine metagenome]   128    3e-27 
ref|ZP_07708220.1|  flagellar MS-ring protein [Bacillus sp. m3-13]     128    3e-27 
gb|ECT28347.1|  hypothetical protein GOS_7062848 [marine metagenome]   128    3e-27 
gb|EBF18634.1|  hypothetical protein GOS_9638896 [marine metagenome]   128    3e-27 
gb|EBE96663.1|  hypothetical protein GOS_9674935 [marine metagenome]   128    3e-27 
gb|ECM73899.1|  hypothetical protein GOS_5216970 [marine metagenome]   127    4e-27 
ref|YP_003671881.1|  flagellar M-ring protein FliF [Geobacillus s...   127    5e-27 
ref|YP_147072.1|  flagellar MS-ring protein [Geobacillus kaustoph...   127    5e-27 
ref|ZP_03052975.1|  flagellar M-ring protein FliF [Bacillus pumil...   127    6e-27 
ref|YP_003253101.1|  flagellar MS-ring protein [Geobacillus sp. Y...   127    6e-27 
ref|ZP_06499879.1|  flagellar MS-ring protein [Pseudomonas syring...   127    6e-27 
ref|YP_003564639.1|  flagellar M-ring protein FliF [Bacillus mega...   127    7e-27 
ref|ZP_05100330.1|  flagellar M-ring protein FliF, putative [Rose...   126    9e-27 
gb|ECV93646.1|  hypothetical protein GOS_2809098 [marine metagenome]   126    9e-27 
ref|ZP_02145462.1|  flagellar M-ring protein FliF [Phaeobacter ga...   126    1e-26 
ref|ZP_02149944.1|  flagellar M-ring protein FliF [Phaeobacter ga...   125    1e-26 
gb|ECC00617.1|  hypothetical protein GOS_5605302 [marine metagenome]   125    2e-26 
ref|ZP_01171526.1|  flagellar M-ring protein [Bacillus sp. NRRL B...   125    2e-26 
gb|ECE13445.1|  hypothetical protein GOS_4163720 [marine metagenome]   125    2e-26 
gb|EBO62710.1|  hypothetical protein GOS_8048524 [marine metagenome]   125    2e-26 
ref|YP_003599360.1|  flagellar M-ring protein FliF [Bacillus mega...   125    2e-26 
gb|EDA94497.1|  hypothetical protein GOS_1908481 [marine metagenome]   125    3e-26 
ref|NP_692476.1|  flagellar MS-ring protein [Oceanobacillus iheye...   125    3e-26 
ref|YP_004644214.1|  flagellar MS-ring protein [Paenibacillus muc...   125    3e-26 
ref|YP_003946301.1|  flagellar m-ring protein flif [Paenibacillus...   124    3e-26 
gb|ECC14419.1|  hypothetical protein GOS_5040136 [marine metagenome]   124    4e-26 
ref|ZP_01625747.1|  flagellar M-ring protein [marine gamma proteo...   124    5e-26 
gb|EDB72335.1|  hypothetical protein GOS_1604831 [marine metagenome]   124    6e-26 
ref|YP_003870257.1|  flagellar M-ring protein FliF [Paenibacillus...   123    7e-26 
gb|EDC92938.1|  hypothetical protein GOS_1389780 [marine metagenome]   123    9e-26 
ref|YP_001838147.1|  flagellar MS-ring protein [Leptospira biflex...   123    1e-25 
ref|ZP_05786108.1|  flagellar M-ring protein FliF [Silicibacter l...   123    1e-25 
ref|ZP_03226176.1|  flagellar MS-ring protein [Bacillus coahuilen...   123    1e-25 
ref|NP_243324.1|  flagellar MS-ring protein [Bacillus halodurans ...   123    1e-25 
gb|EBV18703.1|  hypothetical protein GOS_6943062 [marine metagenome]   122    1e-25 
ref|NP_712772.1|  flagellar MS-ring protein [Leptospira interroga...   122    2e-25 
gb|ECM31743.1|  hypothetical protein GOS_3396118 [marine metagenome]   122    2e-25 
gb|ECB02397.1|  hypothetical protein GOS_6008810 [marine metagenome]   122    2e-25 
ref|YP_004462872.1|  flagellar M-ring protein FliF [Mahella austr...   122    2e-25 
gb|ECF68975.1|  hypothetical protein GOS_5228094 [marine metagenome]   122    2e-25 
gb|ECT45975.1|  hypothetical protein GOS_5889632 [marine metagenome]   122    2e-25 
ref|ZP_05087919.1|  flagellar M-ring protein FliF [Ruegeria sp. R...   122    3e-25 
gb|EBP28772.1|  hypothetical protein GOS_7935359 [marine metagenome]   121    3e-25 
ref|YP_003012176.1|  flagellar MS-ring protein [Paenibacillus sp....   121    4e-25 
dbj|BAE19822.1|  flagellar M-ring protein [Edwardsiella tarda]         121    4e-25 
ref|YP_003244225.1|  flagellar MS-ring protein [Paenibacillus sp....   120    5e-25 
ref|YP_175765.1|  flagellar MS-ring protein [Bacillus clausii KSM...   120    6e-25 
ref|ZP_05079890.1|  flagellar M-ring protein FliF [Rhodobacterale...   120    7e-25 
gb|EBK16059.1|  hypothetical protein GOS_8778498 [marine metagenome]   120    8e-25 
ref|YP_004095491.1|  flagellar M-ring protein FliF [Bacillus cell...   119    1e-24 
ref|ZP_05842391.1|  flagellar M-ring protein FliF [Rhodobacter sp...   119    1e-24 
gb|EBP61990.1|  hypothetical protein GOS_7882074 [marine metagenome]   119    2e-24 
ref|ZP_01116017.1|  flagellar M-ring protein FliF [Reinekea sp. M...   119    2e-24 
gb|ADZ68375.1|  flagellar MS-ring protein [Brucella melitensis M28]    119    2e-24 
ref|NP_541128.1|  flagellar M-ring protein FLIF [Brucella meliten...   119    2e-24 
ref|YP_797561.1|  flagellar MS-ring protein [Leptospira borgpeter...   119    2e-24 
gb|ECJ51788.1|  hypothetical protein GOS_4019345 [marine metagenome]   118    2e-24 
gb|ECM62871.1|  hypothetical protein GOS_5662885 [marine metagenome]   118    2e-24 
ref|ZP_05445820.1|  flagellar M-ring protein FLIF [Brucella melit...   118    2e-24 
ref|YP_614941.1|  flagellar MS-ring protein [Ruegeria sp. TM1040]...   118    3e-24 
gb|EBR26586.1|  hypothetical protein GOS_7627348 [marine metagenome]   118    3e-24 
gb|EDB24470.1|  hypothetical protein GOS_1857657 [marine metagenome]   118    3e-24 
gb|EBM74768.1|  hypothetical protein GOS_8359700 [marine metagenome]   118    3e-24 
gb|EBN88941.1|  hypothetical protein GOS_8171405 [marine metagenome]   118    3e-24 
ref|YP_003874130.1|  flagellar M-ring protein [Spirochaeta thermo...   117    4e-24 
gb|ECM89428.1|  hypothetical protein GOS_4587649 [marine metagenome]   117    4e-24 
ref|ZP_01000699.1|  flagellar FliF M-ring protein [Oceanicola bat...   117    5e-24 
ref|YP_004023181.1|  flagellar m-ring protein flif [Caldicellulos...   116    9e-24 
ref|YP_002887273.1|  flagellar MS-ring protein [Exiguobacterium s...   115    2e-23 
ref|ZP_08194482.1|  flagellar M-ring protein FliF [Clostridium pa...   115    2e-23 
gb|ECB57216.1|  hypothetical protein GOS_3847656 [marine metagenome]   115    2e-23 
ref|YP_002574021.1|  flagellar M-ring protein FliF [Caldicellulos...   115    2e-23 
gb|EFU20149.1|  flagellar M-ring protein FliF [Spirochaeta thermo...   115    3e-23 
ref|YP_003991693.1|  flagellar m-ring protein flif [Caldicellulos...   115    3e-23 
ref|YP_001355.1|  flagellar MS-ring protein [Leptospira interroga...   114    3e-23 
gb|EBY62888.1|  hypothetical protein GOS_5074587 [marine metagenome]   114    4e-23 
gb|EBH22973.1|  hypothetical protein GOS_9298544 [marine metagenome]   114    4e-23 
ref|YP_004003192.1|  flagellar m-ring protein flif [Caldicellulos...   114    6e-23 
ref|ZP_07736479.1|  flagellar M-ring protein FliF [Caldicellulosi...   114    6e-23 
ref|YP_003699815.1|  flagellar M-ring protein FliF [Bacillus sele...   114    6e-23 
gb|EBL00203.1|  hypothetical protein GOS_8639883 [marine metagenome]   114    6e-23 
ref|ZP_07546428.1|  secretory protein YscJ/FliF family protein [T...   114    6e-23 
ref|YP_004025570.1|  flagellar m-ring protein flif [Caldicellulos...   113    8e-23 
gb|EBU58907.1|  hypothetical protein GOS_7037427 [marine metagenome]   113    8e-23 
gb|EDG43083.1|  hypothetical protein GOS_783217 [marine metagenome]    112    1e-22 
gb|EBQ15624.1|  hypothetical protein GOS_7794448 [marine metagenome]   112    1e-22 
gb|EBB42915.1|  hypothetical protein GOS_235057 [marine metagenome]    112    2e-22 
gb|EDD22531.1|  hypothetical protein GOS_1337477 [marine metagenome]   110    5e-22 
gb|ECB09102.1|  hypothetical protein GOS_5746473 [marine metagenome]   110    6e-22 
gb|EBJ65180.1|  hypothetical protein GOS_8862687 [marine metagenome]   110    6e-22 
ref|YP_001318494.1|  flagellar M-ring protein FliF [Alkaliphilus ...   110    6e-22 
ref|ZP_01860976.1|  flagellar M-ring protein [Bacillus sp. SG-1] ...   110    7e-22 
ref|YP_001320536.1|  flagellar M-ring protein FliF [Alkaliphilus ...   109    1e-21 
ref|ZP_07385906.1|  flagellar M-ring protein FliF [Paenibacillus ...   109    1e-21 
gb|EBW29126.1|  hypothetical protein GOS_6769710 [marine metagenome]   109    1e-21 
ref|YP_002506377.1|  flagellar M-ring protein FliF [Clostridium c...   109    1e-21 
ref|ZP_03373443.1|  flagellar MS-ring protein [Salmonella enteric...   109    1e-21 
gb|EBE34059.1|  hypothetical protein GOS_9780288 [marine metagenome]   109    2e-21 
gb|ECK72604.1|  hypothetical protein GOS_6237504 [marine metagenome]   108    2e-21 
ref|YP_003425000.1|  flagellar MS-ring protein [Bacillus pseudofi...   108    2e-21 
gb|EBP70393.1|  hypothetical protein GOS_7868163 [marine metagenome]   108    3e-21 
ref|YP_001697278.1|  flagellar MS-ring protein [Lysinibacillus sp...   108    3e-21 
gb|ECS17431.1|  hypothetical protein GOS_5755343 [marine metagenome]   108    3e-21 
gb|ECD05311.1|  hypothetical protein GOS_4968466 [marine metagenome]   108    3e-21 
ref|ZP_04288702.1|  Flagellar M-ring protein fliF [Bacillus cereu...   108    3e-21 
gb|ECO84520.1|  hypothetical protein GOS_3845537 [marine metagenome]   108    4e-21 
gb|EFS14573.1|  flagellar M-ring domain protein [Shigella flexner...   107    4e-21 
ref|YP_003841207.1|  flagellar M-ring protein FliF [Caldicellulos...   107    5e-21 
ref|ZP_07048117.1|  flagellar MS-ring protein [Lysinibacillus fus...   107    5e-21 
gb|EBL57369.1|  hypothetical protein GOS_8549365 [marine metagenome]   107    5e-21 
gb|ECN21113.1|  hypothetical protein GOS_3339965 [marine metagenome]   107    5e-21 
gb|EBD27393.1|  hypothetical protein GOS_9955762 [marine metagenome]   107    7e-21 
gb|ECS42081.1|  hypothetical protein GOS_4777821 [marine metagenome]   107    7e-21 
ref|ZP_01725667.1|  flagellar M-ring protein [Bacillus sp. B14905...   107    8e-21 
gb|ECN33497.1|  hypothetical protein GOS_6350062 [marine metagenome]   106    1e-20 
ref|YP_001374675.1|  flagellar MS-ring protein [Bacillus cereus s...   106    1e-20 
gb|ECP35162.1|  hypothetical protein GOS_6442309 [marine metagenome]   106    1e-20 
gb|EBB06731.1|  hypothetical protein GOS_294554 [marine metagenome]    106    1e-20 
gb|EBX25844.1|  hypothetical protein GOS_6616102 [marine metagenome]   105    2e-20 
gb|ECD54655.1|  hypothetical protein GOS_3030429 [marine metagenome]   105    2e-20 
gb|ECO66874.1|  hypothetical protein GOS_4513695 [marine metagenome]   105    3e-20 
gb|EDI94731.1|  hypothetical protein GOS_1781133 [marine metagenome]   105    3e-20 
gb|EBY97966.1|  hypothetical protein GOS_3683575 [marine metagenome]   104    3e-20 
gb|EBU05894.1|  hypothetical protein GOS_7172961 [marine metagenome]   104    5e-20 
ref|ZP_03991796.1|  flagellar M-ring protein FliF [Oribacterium s...   103    7e-20 
ref|YP_001180051.1|  flagellar M-ring protein FliF [Caldicellulos...   103    9e-20 
ref|ZP_04233053.1|  Flagellar M-ring protein fliF [Bacillus cereu...   103    1e-19 
ref|ZP_04227205.1|  Flagellar M-ring protein fliF [Bacillus cereu...   103    1e-19 
gb|ECG10597.1|  hypothetical protein GOS_3610684 [marine metagenome]   103    1e-19 
gb|ECQ90303.1|  hypothetical protein GOS_3818497 [marine metagenome]   103    1e-19 
gb|ECG98755.1|  hypothetical protein GOS_3568865 [marine metagenome]   102    2e-19 
ref|ZP_04196764.1|  Flagellar M-ring protein fliF [Bacillus cereu...   102    2e-19 
ref|YP_001644436.1|  flagellar MS-ring protein [Bacillus weihenst...   102    2e-19 
ref|YP_003803283.1|  flagellar M-ring protein FliF [Spirochaeta s...   102    2e-19 
ref|ZP_04294339.1|  Flagellar M-ring protein fliF [Bacillus cereu...   102    2e-19 
gb|ECD05312.1|  hypothetical protein GOS_4968468 [marine metagenome]   102    2e-19 
gb|ECB95797.1|  hypothetical protein GOS_5808303 [marine metagenome]   102    2e-19 
gb|ECJ09079.1|  hypothetical protein GOS_5696875 [marine metagenome]   102    2e-19 
gb|ECQ15596.1|  hypothetical protein GOS_3278585 [marine metagenome]   102    3e-19 
gb|EDI47314.1|  hypothetical protein GOS_426811 [marine metagenome]    101    3e-19 
gb|EBN91817.1|  hypothetical protein GOS_8166758 [marine metagenome]   101    4e-19 
gb|ECY62119.1|  hypothetical protein GOS_2328052 [marine metagenome]   101    4e-19 
gb|ECF60515.1|  hypothetical protein GOS_5578759 [marine metagenome]   101    4e-19 
gb|ECU18581.1|  hypothetical protein GOS_5367858 [marine metagenome]   100    5e-19 
gb|ECD40011.1|  hypothetical protein GOS_3600238 [marine metagenome]   100    7e-19 
gb|ECI24082.1|  hypothetical protein GOS_5587494 [marine metagenome]   100    7e-19 
gb|EBD42861.1|  hypothetical protein GOS_9931363 [marine metagenome]   100    8e-19 
ref|ZP_04299952.1|  Flagellar M-ring protein fliF [Bacillus cereu...   100    8e-19 
gb|ECB37581.1|  hypothetical protein GOS_4612255 [marine metagenome]   100    8e-19 
ref|YP_003823618.1|  flagellar M-ring protein FliF [Clostridium s...   100    9e-19 
ref|ZP_04250529.1|  Flagellar M-ring protein fliF [Bacillus cereu...   100    9e-19 
ref|ZP_04145002.1|  Flagellar M-ring protein fliF [Bacillus thuri...   100    9e-19 
ref|ZP_04095893.1|  Flagellar M-ring protein fliF [Bacillus thuri...   100    1e-18 
ref|ZP_07055125.1|  flagellar MS-ring protein [Bacillus cereus SJ...   100    1e-18 
ref|ZP_04077940.1|  Flagellar M-ring protein fliF [Bacillus thuri...   100    1e-18 
ref|YP_035866.1|  flagellar MS-ring protein [Bacillus thuringiens...   100    1e-18 
ref|ZP_04221940.1|  Flagellar M-ring protein fliF [Bacillus cereu...   100    1e-18 
ref|ZP_04071237.1|  Flagellar M-ring protein fliF [Bacillus thuri...  99.8    1e-18 
gb|EBF61136.1|  hypothetical protein GOS_9569534 [marine metagenome]  99.8    1e-18 
gb|ECR37487.1|  hypothetical protein GOS_5431873 [marine metagenome]  99.8    1e-18 
gb|EBE29170.1|  hypothetical protein GOS_9788406 [marine metagenome]  99.8    1e-18 
dbj|BAK17420.1|  flagellar biosynthesis/type III secretory pathwa...  99.8    1e-18 
ref|YP_027827.1|  flagellar MS-ring protein [Bacillus anthracis s...  99.8    1e-18 
ref|YP_894333.1|  flagellar MS-ring protein [Bacillus thuringiens...  99.8    1e-18 
ref|NP_978086.1|  flagellar MS-ring protein [Bacillus cereus ATCC...  99.4    1e-18 
gb|ADY21024.1|  flagellar MS-ring protein [Bacillus thuringiensis...  99.4    2e-18 
gb|ECJ17727.1|  hypothetical protein GOS_5342328 [marine metagenome]  99.4    2e-18 
ref|YP_004530523.1|  flagellar M-ring protein FliF [Treponema pri...  99.0    2e-18 
ref|ZP_03112356.1|  putative flagellar M-ring protein FliF [Bacil...  99.0    2e-18 
ref|ZP_04101460.1|  Flagellar M-ring protein fliF [Bacillus thuri...  98.6    2e-18 
ref|ZP_00741134.1|  Flagellar M-ring protein fliF [Bacillus thuri...  98.6    2e-18 
ref|ZP_04191210.1|  Flagellar M-ring protein fliF [Bacillus cereu...  98.6    3e-18 
ref|ZP_04173954.1|  Flagellar M-ring protein fliF [Bacillus cereu...  98.6    3e-18 
ref|NP_831422.1|  flagellar MS-ring protein [Bacillus cereus ATCC...  98.6    3e-18 
ref|ZP_04202588.1|  Flagellar M-ring protein fliF [Bacillus cereu...  98.6    3e-18 
ref|ZP_04114221.1|  Flagellar M-ring protein fliF [Bacillus thuri...  98.6    3e-18 
ref|ZP_07054175.1|  flagellar M-ring protein FliF [Listeria grayi...  98.6    3e-18 
ref|YP_002529430.1|  flagellar ms-ring protein [Bacillus cereus Q...  98.6    3e-18 
ref|ZP_03100906.1|  putative flagellar M-ring protein FliF [Bacil...  98.2    3e-18 
ref|ZP_04316854.1|  Flagellar M-ring protein fliF [Bacillus cereu...  98.2    3e-18 
ref|ZP_03231666.1|  putative flagellar M-ring protein FliF [Bacil...  98.2    3e-18 
ref|YP_003664046.1|  flagellar MS-ring protein [Bacillus thuringi...  98.2    3e-18 
ref|ZP_04278176.1|  Flagellar M-ring protein fliF [Bacillus cereu...  98.2    3e-18 
gb|ECC65494.1|  hypothetical protein GOS_3064256 [marine metagenome]  98.2    3e-18 
ref|ZP_04283428.1|  Flagellar M-ring protein fliF [Bacillus cereu...  98.2    3e-18 
ref|YP_002366431.1|  flagellar MS-ring protein [Bacillus cereus B...  98.2    4e-18 
ref|ZP_04238802.1|  Flagellar M-ring protein fliF [Bacillus cereu...  98.2    4e-18 
ref|ZP_04211480.1|  Flagellar M-ring protein fliF [Bacillus cereu...  98.2    4e-18 
ref|ZP_04119762.1|  Flagellar M-ring protein fliF [Bacillus thuri...  98.2    4e-18 
ref|ZP_04083802.1|  Flagellar M-ring protein fliF [Bacillus thuri...  97.8    4e-18 
gb|ECQ90304.1|  hypothetical protein GOS_3818498 [marine metagenome]  97.8    5e-18 
ref|ZP_03235860.1|  putative flagellar M-ring protein FliF [Bacil...  97.8    5e-18 
ref|NP_212425.1|  flagellar MS-ring protein [Borrelia burgdorferi...  97.4    6e-18 
ref|ZP_03539527.1|  flagellar M-ring protein FliF [Borrelia garin...  97.4    6e-18 
ref|YP_072739.1|  flagellar MS-ring protein [Borrelia garinii PBi...  97.4    6e-18 
ref|ZP_03540565.1|  flagellar M-ring protein FliF [Borrelia garin...  97.1    7e-18 
gb|ECO84519.1|  hypothetical protein GOS_3845536 [marine metagenome]  97.1    7e-18 
gb|EDJ58265.1|  hypothetical protein GOS_1670004 [marine metagenome]  97.1    8e-18 
ref|ZP_04322712.1|  Flagellar M-ring protein fliF [Bacillus cereu...  96.7    9e-18 
gb|EBU30185.1|  hypothetical protein GOS_7135294 [marine metagenome]  96.7    1e-17 
ref|ZP_03773318.1|  flagellar M-ring protein FliF [Borrelia sp. S...  96.7    1e-17 
ref|YP_002337778.1|  flagellar MS-ring protein [Bacillus cereus A...  96.3    1e-17 
gb|ECJ66846.1|  hypothetical protein GOS_3436433 [marine metagenome]  96.3    1e-17 
gb|EGH80932.1|  flagellar MS-ring protein [Pseudomonas syringae p...  96.3    1e-17 
ref|ZP_04185509.1|  Flagellar M-ring protein fliF [Bacillus cereu...  96.3    1e-17 
gb|EBJ60517.1|  hypothetical protein GOS_8870469 [marine metagenome]  96.3    2e-17 
ref|ZP_08095362.1|  flagellar MS-ring protein [Planococcus dongha...  95.9    2e-17 
gb|EBV97370.1|  hypothetical protein GOS_6821281 [marine metagenome]  95.9    2e-17 
ref|ZP_03086737.1|  flagellar MS-ring protein [Borrelia burgdorfe...  95.9    2e-17 
gb|EBL91636.1|  hypothetical protein GOS_8493228 [marine metagenome]  95.5    2e-17 
gb|ECE47431.1|  hypothetical protein GOS_6330001 [marine metagenome]  95.5    2e-17 
gb|EBF83577.1|  hypothetical protein GOS_9532839 [marine metagenome]  95.1    3e-17 
ref|ZP_03492593.1|  flagellar M-ring protein FliF [Alicyclobacill...  95.1    3e-17 
gb|EBX83614.1|  hypothetical protein GOS_6525370 [marine metagenome]  94.7    4e-17 
ref|YP_003184805.1|  flagellar M-ring protein FliF [Alicyclobacil...  94.7    4e-17 
gb|ECG99360.1|  hypothetical protein GOS_3545533 [marine metagenome]  94.7    4e-17 
gb|EBT42197.1|  hypothetical protein GOS_7276352 [marine metagenome]  94.7    4e-17 
gb|ECK47795.1|  hypothetical protein GOS_3704879 [marine metagenome]  94.7    4e-17 
gb|ECW97643.1|  hypothetical protein GOS_2621366 [marine metagenome]  94.7    4e-17 
ref|ZP_08539048.1|  flagellar M-ring protein FliF [Oribacterium s...  94.4    6e-17 
gb|EBD94149.1|  hypothetical protein GOS_9847172 [marine metagenome]  94.0    7e-17 
ref|YP_709734.1|  flagellar MS-ring protein [Borrelia afzelii PKo...  93.6    8e-17 
ref|YP_004439531.1|  flagellar M-ring protein FliF [Treponema bre...  93.6    8e-17 
gb|EFU46075.1|  hypothetical protein HMPREF9539_03393 [Escherichi...  92.4    2e-16 
ref|ZP_04850861.1|  flagellar M-ring protein FliF [Paenibacillus ...  92.4    2e-16 
gb|ECJ66845.1|  hypothetical protein GOS_3436431 [marine metagenome]  92.4    2e-16 
ref|ZP_03674969.1|  flagellar M-ring protein FliF [Borrelia spiel...  92.0    2e-16 
ref|ZP_08615186.1|  flagellar M-ring protein FliF [Lachnospiracea...  92.0    2e-16 
gb|ECU22778.1|  hypothetical protein GOS_5201910 [marine metagenome]  91.7    3e-16 
ref|ZP_03672378.1|  flagellar M-ring protein FliF [Borrelia valai...  91.7    4e-16 
gb|EBP42462.1|  hypothetical protein GOS_7913565 [marine metagenome]  91.7    4e-16 
gb|ECE04690.1|  hypothetical protein GOS_4496345 [marine metagenome]  91.7    4e-16 
gb|EBR24405.1|  hypothetical protein GOS_7630852 [marine metagenome]  91.3    4e-16 
gb|EBC96159.1|  hypothetical protein GOS_10007174 [marine metagen...  91.3    4e-16 
ref|YP_001883728.1|  flagellar MS-ring protein [Borrelia hermsii ...  91.3    5e-16 
gb|EGH76063.1|  flagellar MS-ring protein [Pseudomonas syringae p...  90.9    5e-16 
ref|YP_002221952.1|  flagellar M-ring protein [Borrelia duttonii ...  90.9    6e-16 
gb|ECN16276.1|  hypothetical protein GOS_3530886 [marine metagenome]  90.5    7e-16 
gb|EBD54224.1|  hypothetical protein GOS_9912480 [marine metagenome]  90.5    7e-16 
gb|ECG28680.1|  hypothetical protein GOS_6376431 [marine metagenome]  90.5    8e-16 
ref|ZP_02422857.1|  hypothetical protein EUBSIR_01708 [Eubacteriu...  90.5    8e-16 
gb|ECU65591.1|  hypothetical protein GOS_3505962 [marine metagenome]  90.1    1e-15 
ref|YP_002772964.1|  flagellar M-ring protein [Brevibacillus brev...  89.7    1e-15 
gb|EDF19171.1|  hypothetical protein GOS_998747 [marine metagenome]   89.7    1e-15 
ref|YP_561073.1|  secretory protein YscJ/FliF [Shewanella denitri...  89.4    2e-15 
ref|YP_002222766.1|  flagellar M-ring protein [Borrelia recurrent...  89.4    2e-15 
ref|YP_003786552.1|  flagellar M-ring protein FliF [Brachyspira p...  89.4    2e-15 
ref|YP_004526978.1|  flagellar M-ring protein FliF [Treponema azo...  89.0    2e-15 
ref|ZP_03779004.1|  hypothetical protein CLOHYLEM_06074 [Clostrid...  89.0    2e-15 
gb|EGD04393.1|  flagellar MS-ring protein [Burkholderia sp. TJI49]    89.0    2e-15 
gb|EDJ07641.1|  hypothetical protein GOS_1759105 [marine metagenome]  88.6    3e-15 
gb|AEH40342.1|  IIISP family Type III (virulence-related) secreto...  88.6    3e-15 
gb|EBG45391.1|  hypothetical protein GOS_9430538 [marine metagenome]  88.6    3e-15 
ref|YP_004365331.1|  flagellar M-ring protein FliF [Treponema suc...  88.6    3e-15 
ref|YP_002720867.1|  flagellar MS-ring protein [Brachyspira hyody...  88.2    3e-15 
emb|CBK97649.1|  flagellar basal-body M-ring protein/flagellar ho...  88.2    4e-15 
ref|ZP_03509697.1|  flagellar MS-ring protein [Rhizobium etli 8C-3]   88.2    4e-15 
gb|EBO54563.1|  hypothetical protein GOS_8062193 [marine metagenome]  88.2    4e-15 
ref|YP_003632666.1|  flagellar M-ring protein FliF [Brachyspira m...  88.2    4e-15 
gb|EBT27113.1|  hypothetical protein GOS_7301183 [marine metagenome]  87.8    5e-15 
ref|ZP_08035495.1|  flagellar M-ring protein FliF [Treponema phag...  87.8    5e-15 
gb|ECT70934.1|  hypothetical protein GOS_4879730 [marine metagenome]  87.8    5e-15 
gb|ECS21387.1|  hypothetical protein GOS_5596221 [marine metagenome]  87.8    5e-15 
gb|EDG09675.1|  hypothetical protein GOS_841063 [marine metagenome]   87.8    5e-15 
ref|ZP_00237167.1|  flagellar M-ring protein, putative [Bacillus ...  87.8    5e-15 
emb|CBL35316.1|  flagellar basal-body M-ring protein/flagellar ho...  87.8    5e-15 
ref|NP_218839.1|  flagellar MS-ring protein [Treponema pallidum s...  87.4    6e-15 
gb|EBC72972.1|  hypothetical protein GOS_23297 [marine metagenome]    87.0    9e-15 
ref|YP_004092803.1|  flagellar M-ring protein FliF [Ethanoligenen...  85.9    2e-14 
ref|ZP_08604615.1|  flagellar M-ring protein FliF [Lachnospiracea...  85.9    2e-14 
gb|AAB57899.1|  FliF [Treponema denticola]                            85.9    2e-14 
ref|YP_002350867.1|  flagellar M-ring protein FliF [Listeria mono...  85.9    2e-14 
ref|ZP_06556986.1|  flagellar M-ring protein FliF [Listeria monoc...  85.9    2e-14 
gb|ECS10581.1|  hypothetical protein GOS_6029511 [marine metagenome]  85.9    2e-14 
ref|YP_001814348.1|  flagellar MS-ring protein [Exiguobacterium s...  85.9    2e-14 
gb|ECH20477.1|  hypothetical protein GOS_6216788 [marine metagenome]  85.5    2e-14 
ref|ZP_05275811.1|  flagellar MS-ring protein [Listeria monocytog...  85.5    2e-14 
ref|YP_002757451.1|  flagellar basal-body M-ring protein FliF [Li...  85.5    2e-14 
ref|NP_971822.1|  flagellar MS-ring protein [Treponema denticola ...  85.5    3e-14 
ref|YP_013353.1|  flagellar MS-ring protein [Listeria monocytogen...  85.5    3e-14 
ref|ZP_00229472.1|  flagellar M-ring protein FliF [Listeria monoc...  85.5    3e-14 
gb|EGF38358.1|  flagellar MS-ring protein [Listeria monocytogenes...  85.5    3e-14 
ref|YP_003463863.1|  flagellar M-ring protein [Listeria seeligeri...  85.1    3e-14 
gb|EFR85433.1|  flagellar M-ring protein FliF [Listeria monocytog...  85.1    3e-14 
ref|NP_464240.1|  flagellar MS-ring protein [Listeria monocytogen...  85.1    3e-14 
ref|ZP_05297667.1|  flagellar MS-ring protein [Listeria monocytog...  85.1    3e-14 
gb|EDH97156.1|  hypothetical protein GOS_509937 [marine metagenome]   85.1    3e-14 
gb|EFR94654.1|  flagellar M-ring protein FliF [Listeria innocua F...  85.1    3e-14 
ref|ZP_06491620.1|  flagellar MS-ring protein [Xanthomonas campes...  84.7    4e-14 
gb|ECR66868.1|  hypothetical protein GOS_4261883 [marine metagenome]  84.7    4e-14 
ref|YP_945299.1|  flagellar MS-ring protein [Borrelia turicatae 9...  84.7    4e-14 
ref|ZP_07870015.1|  flagellar M-ring protein FliF [Listeria marth...  84.7    4e-14 
ref|ZP_05242431.1|  flagellar MS-ring protein [Listeria monocytog...  84.3    6e-14 
ref|NP_470064.1|  flagellar MS-ring protein [Listeria innocua Cli...  84.3    6e-14 
gb|ECR85184.1|  hypothetical protein GOS_3549194 [marine metagenome]  84.0    6e-14 
gb|EBA74710.1|  hypothetical protein GOS_349293 [marine metagenome]   84.0    6e-14 
gb|EGC76974.1|  FliF protein [Treponema denticola F0402]              84.0    7e-14 
gb|EFR91558.1|  flagellar M-ring protein FliF [Listeria innocua F...  83.6    8e-14 
ref|YP_848883.1|  flagellar MS-ring protein [Listeria welshimeri ...  83.2    1e-13 
gb|EBB36119.1|  hypothetical protein GOS_246339 [marine metagenome]   82.4    2e-13 
gb|ECN71380.1|  hypothetical protein GOS_4812448 [marine metagenome]  82.0    2e-13 
gb|EBT68993.1|  hypothetical protein GOS_7232148 [marine metagenome]  82.0    3e-13 
gb|EBC70827.1|  hypothetical protein GOS_26591 [marine metagenome]    81.6    3e-13 
gb|EDA82902.1|  hypothetical protein GOS_1929819 [marine metagenome]  81.6    3e-13 
ref|ZP_08604560.1|  flagellar M-ring protein FliF [Lachnospiracea...  81.3    4e-13 
gb|ECP77776.1|  hypothetical protein GOS_4733624 [marine metagenome]  81.3    5e-13 
gb|EDH89819.1|  hypothetical protein GOS_522562 [marine metagenome]   81.3    5e-13 
ref|ZP_08187774.1|  flagellar biosynthesis/type III secretory pat...  80.9    5e-13 
ref|ZP_04672023.1|  conserved hypothetical protein [Clostridiales...  80.5    8e-13 
gb|ECV36802.1|  hypothetical protein GOS_2912221 [marine metagenome]  80.5    8e-13 
gb|EBF82856.1|  hypothetical protein GOS_9533998 [marine metagenome]  80.5    8e-13 
ref|YP_004309364.1|  flagellar M-ring protein FliF [Clostridium l...  80.5    8e-13 
gb|AAA87352.1|  flagellar MS-ring protein [Borrelia burgdorferi]      80.1    9e-13 
gb|ECR89451.1|  hypothetical protein GOS_3377367 [marine metagenome]  80.1    9e-13 
gb|ECJ03715.1|  hypothetical protein GOS_5913284 [marine metagenome]  80.1    1e-12 
gb|ECL47890.1|  hypothetical protein GOS_3242460 [marine metagenome]  80.1    1e-12 
gb|EDI79582.1|  hypothetical protein GOS_373493 [marine metagenome]   80.1    1e-12 
gb|EDJ66822.1|  hypothetical protein GOS_1654542 [marine metagenome]  79.7    1e-12 
ref|ZP_08139766.1|  flagellar MS-ring protein [Pseudomonas sp. TJ...  79.3    2e-12 
gb|ECZ70540.1|  hypothetical protein GOS_2135642 [marine metagenome]  79.3    2e-12 
gb|ECB25012.1|  hypothetical protein GOS_5114044 [marine metagenome]  79.3    2e-12 
ref|ZP_05429758.1|  flagellar M-ring protein FliF [Clostridium th...  79.0    2e-12 
ref|YP_001036896.1|  flagellar M-ring protein FliF [Clostridium t...  79.0    2e-12 
gb|EBE10452.1|  hypothetical protein GOS_9820165 [marine metagenome]  78.6    3e-12 
gb|EBX26768.1|  hypothetical protein GOS_6614614 [marine metagenome]  78.6    3e-12 
gb|ECC14420.1|  hypothetical protein GOS_5040138 [marine metagenome]  78.2    3e-12 
ref|ZP_02087014.1|  hypothetical protein CLOBOL_04558 [Clostridiu...  77.8    4e-12 
ref|ZP_07838496.1|  flagellar M-ring protein FliF [Eubacterium ce...  77.4    7e-12 
gb|ECJ82120.1|  hypothetical protein GOS_6321724 [marine metagenome]  77.0    9e-12 
gb|EBQ31238.1|  hypothetical protein GOS_7770240 [marine metagenome]  76.3    1e-11 
gb|EBU33914.1|  hypothetical protein GOS_7129601 [marine metagenome]  76.3    2e-11 
gb|EBB47444.1|  hypothetical protein GOS_227450 [marine metagenome]   75.9    2e-11 
ref|ZP_03245198.1|  flagellar MS-ring protein [Helicobacter pylor...  75.9    2e-11 
gb|EBT32869.1|  hypothetical protein GOS_7291867 [marine metagenome]  75.5    2e-11 
gb|ECJ56298.1|  hypothetical protein GOS_3846505 [marine metagenome]  75.5    3e-11 
gb|EBX41502.1|  hypothetical protein GOS_6590946 [marine metagenome]  75.1    3e-11 
ref|ZP_07326807.1|  flagellar M-ring protein FliF [Acetivibrio ce...  74.3    6e-11 
ref|ZP_06116271.1|  flagellar M-ring protein FliF [Clostridium ha...  73.9    7e-11 
gb|EBP50423.1|  hypothetical protein GOS_7900834 [marine metagenome]  73.9    8e-11 
gb|ECC21363.1|  hypothetical protein GOS_4766746 [marine metagenome]  73.6    8e-11 
gb|EBT31986.1|  hypothetical protein GOS_7293357 [marine metagenome]  73.6    9e-11 
gb|ECF01423.1|  hypothetical protein GOS_4384418 [marine metagenome]  73.2    1e-10 
gb|ECO02927.1|  hypothetical protein GOS_3602674 [marine metagenome]  72.8    2e-10 
gb|ECF08915.1|  hypothetical protein GOS_4115733 [marine metagenome]  72.8    2e-10 
gb|ECF16735.1|  hypothetical protein GOS_3808149 [marine metagenome]  72.0    3e-10 
gb|EBD22843.1|  hypothetical protein GOS_9963676 [marine metagenome]  72.0    3e-10 
gb|EBP70361.1|  hypothetical protein GOS_7868210 [marine metagenome]  72.0    3e-10 
gb|ECN04223.1|  hypothetical protein GOS_4007539 [marine metagenome]  70.9    7e-10 
ref|YP_002937686.1|  flagellar biosynthesis/type III secretory pa...  70.5    7e-10 
gb|EGH43724.1|  flagellar MS-ring protein [Pseudomonas syringae p...  70.5    9e-10 
gb|EDC39252.1|  hypothetical protein GOS_1484154 [marine metagenome]  70.1    1e-09 
ref|YP_003830678.1|  flagellar M-ring protein FliF [Butyrivibrio ...  69.7    1e-09 
ref|ZP_05623046.1|  flagellar M-ring protein FliF [Treponema vinc...  68.9    2e-09 
gb|EBW46843.1|  hypothetical protein GOS_6742152 [marine metagenome]  68.9    2e-09 
gb|ECL24015.1|  hypothetical protein GOS_4167634 [marine metagenome]  68.9    3e-09 
gb|EBX17419.1|  hypothetical protein GOS_6629095 [marine metagenome]  68.6    3e-09 
gb|EBY97967.1|  hypothetical protein GOS_3683576 [marine metagenome]  68.2    4e-09 
gb|EBV90410.1|  hypothetical protein GOS_6832463 [marine metagenome]  68.2    4e-09 
ref|ZP_03462464.1|  hypothetical protein BACPEC_01529 [Bacteroide...  67.8    5e-09 
gb|EBN57233.1|  hypothetical protein GOS_8224173 [marine metagenome]  67.8    5e-09 
gb|ECA98975.1|  hypothetical protein GOS_6153432 [marine metagenome]  67.8    5e-09 
gb|AAF35844.1|AF220002_1  flagellar M ring protein FliF [Rhodospi...  67.8    6e-09 
gb|ECO01989.1|  hypothetical protein GOS_3636150 [marine metagenome]  67.4    7e-09 
gb|EBZ64731.1|  hypothetical protein GOS_4487956 [marine metagenome]  67.4    7e-09 
gb|EBW75806.1|  hypothetical protein GOS_6696237 [marine metagenome]  66.6    1e-08 
gb|ECB28714.1|  hypothetical protein GOS_4971024 [marine metagenome]  66.6    1e-08 
ref|ZP_03752538.1|  hypothetical protein ROSEINA2194_00942 [Roseb...  66.6    1e-08 
gb|ECU72067.1|  hypothetical protein GOS_3263074 [marine metagenome]  65.9    2e-08 
gb|EBY13128.1|  hypothetical protein GOS_4674838 [marine metagenome]  65.9    2e-08 
gb|EBZ70750.1|  hypothetical protein GOS_4266689 [marine metagenome]  65.9    2e-08 
gb|ECM33736.1|  hypothetical protein GOS_3321139 [marine metagenome]  65.9    2e-08 
ref|ZP_02692651.1|  flagellar M-ring protein FliF [Epulopiscium s...  65.5    3e-08 
gb|EBF64051.1|  hypothetical protein GOS_9564733 [marine metagenome]  65.1    3e-08 
gb|ECG98756.1|  hypothetical protein GOS_3568867 [marine metagenome]  64.7    5e-08 
gb|EBI85227.1|  hypothetical protein GOS_9023141 [marine metagenome]  64.3    5e-08 
gb|EBG01119.1|  hypothetical protein GOS_9504264 [marine metagenome]  64.3    6e-08 
ref|ZP_00051978.1|  COG1766: Flagellar biosynthesis/type III secr...  64.3    6e-08 
gb|EDJ55297.1|  hypothetical protein GOS_1675325 [marine metagenome]  63.9    7e-08 
gb|EBH74687.1|  hypothetical protein GOS_9209730 [marine metagenome]  63.9    7e-08 
ref|ZP_02442271.1|  hypothetical protein ANACOL_01561 [Anaerotrun...  63.9    7e-08 
gb|EDI03773.1|  hypothetical protein GOS_499580 [marine metagenome]   63.9    8e-08 
gb|EDB39236.1|  hypothetical protein GOS_1831940 [marine metagenome]  63.9    8e-08 
gb|EBZ81651.1|  hypothetical protein GOS_3839815 [marine metagenome]  63.9    8e-08 
emb|CBL09114.1|  flagellar basal-body M-ring protein/flagellar ho...  63.5    1e-07 
gb|ECD54657.1|  hypothetical protein GOS_3030432 [marine metagenome]  63.5    1e-07 
ref|ZP_04744108.2|  flagellar M-ring protein FliF [Roseburia inte...  63.2    1e-07 
gb|EBU12530.1|  hypothetical protein GOS_7162598 [marine metagenome]  63.2    1e-07 
gb|EBV99219.1|  hypothetical protein GOS_6818402 [marine metagenome]  63.2    1e-07 
ref|ZP_07546429.1|  Flagellar M-ring domain protein [Thermoanaero...  62.8    1e-07 
gb|EBP36655.1|  hypothetical protein GOS_7922964 [marine metagenome]  62.4    2e-07 
gb|ECQ04465.1|  hypothetical protein GOS_3694934 [marine metagenome]  62.4    2e-07 
gb|EBJ42056.1|  hypothetical protein GOS_8901258 [marine metagenome]  62.4    2e-07 
gb|ECF07355.1|  hypothetical protein GOS_4175722 [marine metagenome]  62.0    3e-07 
gb|EDG22436.1|  hypothetical protein GOS_818948 [marine metagenome]   62.0    3e-07 
gb|EBT92774.1|  hypothetical protein GOS_7193136 [marine metagenome]  61.6    3e-07 
ref|ZP_02692700.1|  flagellar M-ring protein FliF [Epulopiscium s...  61.6    4e-07 
dbj|BAI85247.1|  hypothetical protein BSNT_02643 [Bacillus subtil...  60.5    8e-07 
gb|EBU46386.1|  hypothetical protein GOS_7110605 [marine metagenome]  60.1    1e-06 
gb|EBG61930.1|  hypothetical protein GOS_9402702 [marine metagenome]  60.1    1e-06 
ref|YP_002930263.1|  flagellar M-ring protein FliF [Eubacterium e...  60.1    1e-06 
gb|ECI70755.1|  hypothetical protein GOS_3741096 [marine metagenome]  59.7    1e-06 
gb|ECM85673.1|  hypothetical protein GOS_4739672 [marine metagenome]  59.7    1e-06 
gb|ECM85671.1|  hypothetical protein GOS_4739670 [marine metagenome]  59.3    2e-06 
gb|ECY26623.1|  hypothetical protein GOS_2388952 [marine metagenome]  59.3    2e-06 
gb|ECU48672.1|  hypothetical protein GOS_4177049 [marine metagenome]  58.5    3e-06 
gb|ECP77777.1|  hypothetical protein GOS_4733625 [marine metagenome]  58.5    3e-06 
gb|EBV64226.1|  hypothetical protein GOS_6873291 [marine metagenome]  58.5    3e-06 
gb|EBO62711.1|  hypothetical protein GOS_8048526 [marine metagenome]  58.5    3e-06 
ref|NP_541129.1|  flagellar M-ring protein FLIF [Brucella meliten...  58.2    4e-06 
gb|EBH22972.1|  hypothetical protein GOS_9298543 [marine metagenome]  57.8    6e-06 
ref|ZP_05453091.1|  flagellar MS-ring protein [Brucella melitensi...  57.8    6e-06 
gb|EBK48783.1|  hypothetical protein GOS_8724435 [marine metagenome]  57.4    6e-06 
ref|ZP_08402363.1|  YscJ/HrcJ family type III secretion apparatus...  57.4    7e-06 
ref|YP_001377945.1|  secretory protein YscJ/FliF family protein [...  57.0    8e-06 
ref|ZP_03506567.1|  flagellar MS-ring protein [Rhizobium etli Bra...  56.6    1e-05 
ref|YP_001779547.1|  YscJ/HrcJ family type III secretion apparatu...  56.6    1e-05 
gb|EBK43346.1|  hypothetical protein GOS_8733626 [marine metagenome]  56.6    1e-05 
gb|ECR27143.1|  hypothetical protein GOS_5854246 [marine metagenome]  56.2    2e-05 
gb|EBU75198.1|  hypothetical protein GOS_7011657 [marine metagenome]  56.2    2e-05 
gb|EBZ11866.1|  hypothetical protein GOS_3150181 [marine metagenome]  55.8    2e-05 
ref|ZP_01000494.1|  flagellar M-ring protein [Oceanicola batsensi...  55.8    2e-05 
gb|ECH23334.1|  hypothetical protein GOS_6097496 [marine metagenome]  55.8    2e-05 
gb|ECU68794.1|  hypothetical protein GOS_3384244 [marine metagenome]  55.8    2e-05 
gb|ECE60988.1|  hypothetical protein GOS_6008421 [marine metagenome]  55.5    2e-05 
gb|EBN83208.1|  hypothetical protein GOS_8181042 [marine metagenome]  55.1    3e-05 
ref|ZP_02534387.1|  flagellar MS-ring protein [Endoriftia perseph...  55.1    4e-05 
gb|EGH43725.1|  flagellar MS-ring protein [Pseudomonas syringae p...  54.7    5e-05 
gb|EBE96662.1|  hypothetical protein GOS_9674934 [marine metagenome]  53.9    7e-05 
ref|ZP_01037249.1|  flagellar M-ring protein FliF [Roseovarius sp...  53.9    8e-05 
gb|EBI57551.1|  hypothetical protein GOS_9069487 [marine metagenome]  53.9    8e-05 
ref|ZP_03244974.1|  flagellar MS-ring protein [Helicobacter pylor...  53.9    8e-05 
gb|ECF30213.1|  hypothetical protein GOS_3273545 [marine metagenome]  53.9    9e-05 
gb|ECY41522.1|  hypothetical protein GOS_2364326 [marine metagenome]  53.5    9e-05 
ref|ZP_02931211.1|  type III secretion apparatus lipoprotein, Ysc...  53.5    9e-05 
gb|ECK46443.1|  hypothetical protein GOS_3755884 [marine metagenome]  53.5    1e-04 
gb|ECT51312.1|  hypothetical protein GOS_5672370 [marine metagenome]  53.1    1e-04 
gb|ECO70577.1|  hypothetical protein GOS_4363094 [marine metagenome]  53.1    1e-04 
gb|EBB33118.1|  hypothetical protein GOS_251485 [marine metagenome]   52.8    2e-04 
gb|EBN84909.1|  hypothetical protein GOS_8178152 [marine metagenome]  52.8    2e-04 
ref|ZP_02534388.1|  flagellar basal-body M-ring protein FliF [End...  52.8    2e-04 
gb|EBG39738.1|  hypothetical protein GOS_9439977 [marine metagenome]  52.8    2e-04 
gb|ECN12897.1|  hypothetical protein GOS_3657056 [marine metagenome]  52.4    2e-04 
ref|ZP_02908147.1|  type III secretion apparatus lipoprotein, Ysc...  52.4    2e-04 
gb|ECR85185.1|  hypothetical protein GOS_3549196 [marine metagenome]  52.4    2e-04 
gb|ECH86143.1|  hypothetical protein GOS_3581515 [marine metagenome]  52.0    3e-04 
gb|ECF84835.1|  hypothetical protein GOS_4599480 [marine metagenome]  52.0    3e-04 
gb|ECQ26727.1|  hypothetical protein GOS_6329406 [marine metagenome]  51.6    4e-04 
ref|ZP_05083260.1|  type III secretion apparatus lipoprotein, Ysc...  51.6    4e-04 
ref|YP_002133110.1|  secretory protein YscJ/FliF family protein [...  51.6    4e-04 
gb|ECS42080.1|  hypothetical protein GOS_4777820 [marine metagenome]  51.6    4e-04 
gb|EBI85228.1|  hypothetical protein GOS_9023142 [marine metagenome]  51.2    5e-04 
ref|ZP_08267646.1|  hypothetical protein BDIM_09830 [Brevundimona...  50.8    6e-04 
gb|ECN16275.1|  hypothetical protein GOS_3530884 [marine metagenome]  50.8    7e-04 
emb|CBL40835.1|  Flagellar biosynthesis/type III secretory pathwa...  50.4    8e-04 
gb|EBY23912.1|  hypothetical protein GOS_3416923 [marine metagenome]  50.4    8e-04 
ref|ZP_03506049.1|  flagellar MS-ring protein [Rhizobium etli Bra...  50.4    8e-04 
gb|EDF42177.1|  hypothetical protein GOS_958021 [marine metagenome]   50.4    9e-04 
ref|YP_002888182.1|  type III secretion system protein, membrane ...  50.4    0.001 
gb|ECR99747.1|  hypothetical protein GOS_6452695 [marine metagenome]  50.1    0.001 
ref|YP_001653904.1|  type III secretion system protein, membrane ...  50.1    0.001 
ref|YP_001654892.1|  type III secretion system protein, membrane ...  50.1    0.001 
gb|EDB02670.1|  hypothetical protein GOS_1894348 [marine metagenome]  50.1    0.001 
emb|CCB86648.1|  type III secretion periplasmic lipoprotein [Para...  50.1    0.001 
ref|ZP_06299245.1|  type III secretion lipoprotein SctJ [Parachla...  49.7    0.001 
ref|ZP_05380946.1|  type III secretion system protein, membrane c...  49.7    0.001 
gb|ADI51235.1|  type III secretion cytoplasmic membrane protein S...  49.7    0.001 
ref|ZP_05353947.1|  type III secretion system protein, membrane c...  49.7    0.001 
ref|NP_220074.1|  Yop proteins translocation lipoprotein J [Chlam...  49.7    0.001 
gb|ECS19047.1|  hypothetical protein GOS_5690006 [marine metagenome]  49.7    0.002 
gb|EDJ09304.1|  hypothetical protein GOS_1756201 [marine metagenome]  49.3    0.002 
gb|EBD89936.1|  hypothetical protein GOS_9854225 [marine metagenome]  49.3    0.002 
gb|EBV66603.1|  hypothetical protein GOS_6869432 [marine metagenome]  49.3    0.002 
ref|ZP_01914330.1|  putative type III secretion protein [Limnobac...  48.9    0.003 
ref|ZP_01303336.1|  hrp conserved lipoprotein hrcj transmembrane ...  48.5    0.003 
gb|EFV87788.1|  BscJ protein [Achromobacter xylosoxidans C54]         48.5    0.003 
gb|EBD92160.1|  hypothetical protein GOS_9850570 [marine metagenome]  48.5    0.003 
gb|EBP94980.1|  hypothetical protein GOS_7827793 [marine metagenome]  48.5    0.004 
ref|ZP_07662858.1|  type III secretion apparatus lipoprotein, Ysc...  48.1    0.004 
gb|ECM14468.1|  hypothetical protein GOS_4068529 [marine metagenome]  48.1    0.004 
gb|EBY73532.1|  hypothetical protein GOS_4636154 [marine metagenome]  48.1    0.005 
gb|EBD53398.1|  hypothetical protein GOS_9913837 [marine metagenome]  47.8    0.005 
emb|CBL40836.1|  Flagellar biosynthesis/type III secretory pathwa...  47.8    0.005 
gb|EDJ66056.1|  hypothetical protein GOS_1655939 [marine metagenome]  47.8    0.006 
ref|YP_003811260.1|  Type III secretion pathway protein [gamma pr...  47.4    0.007 
ref|YP_002491164.1|  secretory protein YscJ/FliF family protein [...  47.4    0.007 
gb|AAG47968.1|AF312695_8  FliF [Pseudomonas fluorescens]              47.4    0.007 
gb|EBW80649.1|  hypothetical protein GOS_6688610 [marine metagenome]  47.4    0.008 
gb|EBY34790.1|  hypothetical protein GOS_6221411 [marine metagenome]  47.4    0.008 
ref|ZP_03500771.1|  flagellar MS-ring protein [Rhizobium etli Kim 5]  47.0    0.009 
gb|EBA68954.1|  hypothetical protein GOS_359160 [marine metagenom...  47.0    0.010 
gb|ECJ17725.1|  hypothetical protein GOS_5342326 [marine metagenome]  47.0    0.010 
gb|ECR07605.1|  hypothetical protein GOS_3137935 [marine metagenome]  46.6    0.011 
gb|ECL55616.1|  hypothetical protein GOS_6421120 [marine metagenome]  46.6    0.012 
gb|EBE56064.1|  hypothetical protein GOS_9743234 [marine metagenome]  46.6    0.013 
gb|EBT91398.1|  hypothetical protein GOS_7195320 [marine metagenome]  46.2    0.017 
gb|EBQ69859.1|  hypothetical protein GOS_7711501 [marine metagenome]  46.2    0.017 
gb|EGH51094.1|  type III secretion protein HrcJ [Pseudomonas syri...  46.2    0.017 
gb|AAB05080.1|  HrcJ [Pseudomonas syringae pv. syringae]              46.2    0.017 
ref|ZP_06498918.1|  type III secretion protein HrcJ [Pseudomonas ...  46.2    0.017 
gb|EGH69184.1|  type III secretion protein HrcJ [Pseudomonas syri...  46.2    0.018 
ref|YP_234287.1|  type III secretion protein HrcJ [Pseudomonas sy...  45.8    0.019 
gb|EGH75918.1|  type III secretion protein HrcJ [Pseudomonas syri...  45.8    0.019 
emb|CBK74818.1|  flagellar basal-body M-ring protein/flagellar ho...  45.8    0.020 
gb|EGH41134.1|  type III secretion protein HrcJ [Pseudomonas syri...  45.4    0.026 
ref|YP_002824490.1|  type III secretion component, RhcJ protein [...  45.4    0.028 
gb|EGH57735.1|  type III secretion protein HrcJ [Pseudomonas syri...  45.4    0.030 
gb|ECJ14736.1|  hypothetical protein GOS_5473136 [marine metagenome]  45.4    0.031 
gb|EBN82368.1|  hypothetical protein GOS_8182424 [marine metagenome]  45.1    0.031 
gb|EBD09016.1|  hypothetical protein GOS_9985800 [marine metagenome]  45.1    0.032 
gb|ABB91658.1|  type III secretion protein HrcJ [Pseudomonas syri...  45.1    0.032 
gb|EBI68235.1|  hypothetical protein GOS_9051419 [marine metagenome]  45.1    0.035 
gb|EDE72160.1|  hypothetical protein GOS_1081651 [marine metagenome]  45.1    0.035 
gb|EGH27112.1|  type III secretion protein HrcJ [Pseudomonas syri...  45.1    0.035 
ref|YP_001888945.1|  type III secretion apparatus lipoprotein, Ys...  45.1    0.039 
ref|YP_463919.1|  secretory protein YscJ/FliF [Anaeromyxobacter d...  44.7    0.042 
gb|EGH83056.1|  type III secretion protein HrcJ [Pseudomonas syri...  44.7    0.043 
gb|ABL59995.1|  SctJ [Lysobacter enzymogenes]                         44.7    0.043 
ref|NP_297221.1|  type III secretion protein SctJ [Chlamydia muri...  44.7    0.048 
gb|ECU65592.1|  hypothetical protein GOS_3505963 [marine metagenome]  44.7    0.051 
gb|EFS04021.1|  flagellar M-ring protein FliF [Listeria seeligeri...  44.3    0.067 
ref|YP_557905.1|  secretory protein YscJ/FliF [Burkholderia xenov...  43.9    0.071 
ref|ZP_07872962.1|  flagellar M-ring protein FliF [Listeria ivano...  43.9    0.072 
ref|ZP_01089536.1|  probable polar flagellar M-ring protein FliF ...  43.9    0.072 
ref|ZP_04588450.1|  type III secretion protein HrcJ [Pseudomonas ...  43.9    0.073 
ref|ZP_07005148.1|  type III secretion system lipoprotein [Pseudo...  43.9    0.083 
gb|EFS00945.1|  flagellar M-ring protein FliF [Listeria seeligeri...  43.9    0.088 
emb|CAQ57550.1|  RhcJ protein [Bradyrhizobium elkanii]                43.9    0.090 


>ref|NP_416448.1| flagellar basal-body MS-ring and collar protein [Escherichia 
coli str. K-12 substr. MG1655]
 ref|AP_002550.1| flagellar basal-body MS-ring and collar protein [Escherichia 
coli str. K-12 substr. W3110]
 ref|YP_001458727.1| flagellar MS-ring protein [Escherichia coli HS]
 33 more sequence titles
 Length=552

 Score = 1120 bits (2896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/552 (100%), Positives = 552/552 (100%), Gaps = 0/552 (0%)

Query  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60
            MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60

Query  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120
            GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120

Query  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180
            SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180

Query  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240
            RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240

Query  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300
            RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300

Query  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360
            SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360

Query  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420
            DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420

Query  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480
            SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480

Query  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540
            EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540

Query  541  LVIRQWINNDHE  552
            LVIRQWINNDHE
Sbjct  541  LVIRQWINNDHE  552


>ref|YP_002412950.1| flagellar MS-ring protein [Escherichia coli UMN026]
 ref|ZP_06649413.1| fliF [Escherichia coli FVEC1412]
 ref|ZP_06990663.1| flagellar M-ring protein [Escherichia coli FVEC1302]
 emb|CAR13421.1| flagellar basal-body MS-ring and collar protein [Escherichia 
coli UMN026]
 gb|EFF00656.1| fliF [Escherichia coli FVEC1412]
 gb|EFI20020.1| flagellar M-ring protein [Escherichia coli FVEC1302]
Length=552

 Score = 1119 bits (2894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/552 (99%), Positives = 552/552 (100%), Gaps = 0/552 (0%)

Query  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60
            MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60

Query  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120
            GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120

Query  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180
            SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180

Query  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240
            RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240

Query  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300
            RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300

Query  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360
            SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360

Query  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420
            DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420

Query  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480
            SLNVVNSPFNSSDESGGELPFWQQQAFIDQL+AAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLMAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480

Query  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540
            EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540

Query  541  LVIRQWINNDHE  552
            LVIRQWINNDHE
Sbjct  541  LVIRQWINNDHE  552


>ref|ZP_03047436.1| flagellar M-ring protein FliF [Escherichia coli E22]
 ref|ZP_03062458.1| flagellar M-ring protein FliF [Escherichia coli B171]
 ref|ZP_07220930.1| flagellar M-ring protein FliF [Escherichia coli MS 78-1]
 6 more sequence titles
 Length=552

 Score = 1119 bits (2894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/552 (99%), Positives = 551/552 (99%), Gaps = 0/552 (0%)

Query  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60
            MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60

Query  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120
            GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120

Query  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180
            SQFSEQVNYQRALEGELSRTI TIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct  121  SQFSEQVNYQRALEGELSRTIATIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180

Query  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240
            RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240

Query  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300
            RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300

Query  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360
            SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360

Query  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420
            DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420

Query  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480
            SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480

Query  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540
            EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540

Query  541  LVIRQWINNDHE  552
            LVIRQWINNDHE
Sbjct  541  LVIRQWINNDHE  552


>ref|YP_310897.1| flagellar MS-ring protein [Shigella sonnei Ss046]
 gb|AAZ88662.1| flagellar basal-body MS(membrane and supramembrane)-ring and 
collar protein [Shigella sonnei Ss046]
 gb|EFZ54623.1| flagellar M-ring protein FliF [Shigella sonnei 53G]
Length=552

 Score = 1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/552 (99%), Positives = 551/552 (99%), Gaps = 0/552 (0%)

Query  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60
            MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60

Query  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120
            GAIVSQLTQMNIPY FSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct  61   GAIVSQLTQMNIPYCFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120

Query  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180
            SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180

Query  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240
            RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240

Query  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300
            RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300

Query  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360
            SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360

Query  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420
            DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420

Query  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480
            SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480

Query  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540
            EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540

Query  541  LVIRQWINNDHE  552
            LVIRQWINNDHE
Sbjct  541  LVIRQWINNDHE  552


>ref|YP_001463240.1| flagellar MS-ring protein [Escherichia coli E24377A]
 gb|ABV20604.1| flagellar M-ring protein FliF [Escherichia coli E24377A]
Length=552

 Score = 1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/552 (99%), Positives = 551/552 (99%), Gaps = 0/552 (0%)

Query  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60
            MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60

Query  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120
            GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120

Query  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180
            SQFSEQVNYQRALEGELSRTI TIGPVKGARVHLAMPKPSLFVREQKSPSASVT+NLLPG
Sbjct  121  SQFSEQVNYQRALEGELSRTIATIGPVKGARVHLAMPKPSLFVREQKSPSASVTINLLPG  180

Query  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240
            RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240

Query  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300
            RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300

Query  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360
            SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360

Query  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420
            DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420

Query  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480
            SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480

Query  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540
            EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540

Query  541  LVIRQWINNDHE  552
            LVIRQWINNDHE
Sbjct  541  LVIRQWINNDHE  552


>ref|YP_001724683.1| flagellar MS-ring protein [Escherichia coli ATCC 8739]
 ref|ZP_02999617.1| flagellar M-ring protein FliF [Escherichia coli 53638]
 ref|ZP_07165396.1| flagellar M-ring protein FliF [Escherichia coli MS 116-1]
 6 more sequence titles
 Length=552

 Score = 1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/552 (99%), Positives = 551/552 (99%), Gaps = 0/552 (0%)

Query  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60
            MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60

Query  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120
            GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120

Query  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180
            SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180

Query  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240
            RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQ NTSGRDLNDAQLKYASDVEG
Sbjct  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQFNTSGRDLNDAQLKYASDVEG  240

Query  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300
            RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300

Query  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360
            SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360

Query  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420
            DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420

Query  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480
            SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480

Query  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540
            EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540

Query  541  LVIRQWINNDHE  552
            LVIRQWINNDHE
Sbjct  541  LVIRQWINNDHE  552


>gb|AEE56998.1| flagellar M-ring protein FliF [Escherichia coli UMNK88]
Length=552

 Score = 1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/552 (99%), Positives = 550/552 (99%), Gaps = 0/552 (0%)

Query  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60
            MNATAAQTKSLEWLNRLRANPKIPLIV GSAAVAVMVALILWAK PDYRTLFSNLSDQDG
Sbjct  1    MNATAAQTKSLEWLNRLRANPKIPLIVTGSAAVAVMVALILWAKTPDYRTLFSNLSDQDG  60

Query  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120
            GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120

Query  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180
            SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180

Query  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240
            RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240

Query  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300
            RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300

Query  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360
            SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360

Query  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420
            DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
Sbjct  361  DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD  420

Query  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480
            SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
Sbjct  421  SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA  480

Query  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540
            EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
Sbjct  481  EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA  540

Query  541  LVIRQWINNDHE  552
            LVIRQWINNDHE
Sbjct  541  LVIRQWINNDHE  552


>gb|EFW50572.1| Flagellar M-ring protein FliF [Shigella dysenteriae CDC 74-1112]
Length=552

 Score = 1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/552 (99%), Positives = 551/552 (99%), Gaps = 0/552 (0%)

Query  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60
            MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
Sbjct  1    MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG  60

Query  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120
            GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
Sbjct  61   GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI  120

Query  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180
            SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
Sbjct  121  SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG  180

Query  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240
            RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
Sbjct  181  RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG  240

Query  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300
            RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
Sbjct  241  RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ  300

Query  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV  360
            SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
Sbjct  301  SGSGYPGGVPGALSNQPAPANNAPISTPPANQNN