BLAST Search Results

Blast performed on February-3-2012 BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: nr_env 20,512,688 sequences; 6,167,035,527 total letters Query= EG10345 ftsX Length=352 Score E Sequences producing significant alignments: (Bits) Value ref|ZP_03063518.1| cell division protein FtsX [Shigella dysenter... 719 0.0 ref|YP_859063.1| cell division protein FtsX [Escherichia coli AP... 719 0.0 ref|NP_417919.1| predicted transporter subunit: membrane compone... 718 0.0 ref|ZP_07185776.1| ABC transporter, FtsX cell division permease ... 717 0.0 ref|YP_003231459.1| putative transporter subunit [Escherichia co... 717 0.0 gb|EGB61563.1| cell division transport system permease [Escheric... 717 0.0 ref|ZP_08365972.1| putative protein insertion permease FtsX [Esc... 717 0.0 ref|ZP_07146355.1| ABC transporter, FtsX cell division permease ... 717 0.0 ref|ZP_03049824.1| cell division protein FtsX [Escherichia coli ... 717 0.0 ref|ZP_07786447.1| putative protein insertion permease FtsX [Esc... 717 0.0 ref|NP_290010.1| cell division protein FtsX [Escherichia coli O1... 717 0.0 ref|ZP_07142608.1| ABC transporter, FtsX cell division permease ... 717 0.0 gb|ADR28842.1| cell division protein FtsX [Escherichia coli O83:... 717 0.0 ref|YP_409772.1| cell division protein FtsX [Shigella boydii Sb2... 716 0.0 gb|AEG38410.1| Cell division protein FtsX [Escherichia coli NA114] 716 0.0 ref|YP_312481.1| cell division protein FtsX [Shigella sonnei Ss0... 716 0.0 ref|YP_003236589.1| putative transporter subunit [Escherichia co... 714 0.0 gb|EFW50795.1| Cell division protein FtsX [Shigella dysenteriae ... 714 0.0 ref|ZP_02901408.1| cell division protein FtsX [Escherichia alber... 712 0.0 ref|ZP_06355596.2| ABC transporter, FtsX cell division permease ... 680 0.0 ref|ZP_04559258.1| cell division protein FtsX [Citrobacter sp. 3... 673 0.0 ref|YP_001456369.1| cell division protein FtsX [Citrobacter kose... 669 0.0 ref|NP_462470.1| cell division protein FtsX [Salmonella enterica... 666 0.0 ref|ZP_02660221.1| cell division protein FtsX [Salmonella enteri... 666 0.0 gb|EGE31653.1| cell division protein FtsX [Salmonella enterica s... 665 0.0 ref|ZP_02830614.1| cell division protein FtsX [Salmonella enteri... 664 0.0 ref|ZP_03219940.1| cell division protein FtsX [Salmonella enteri... 664 0.0 ref|YP_218485.1| cell division protein FtsX [Salmonella enterica... 664 0.0 ref|YP_152543.1| cell division protein FtsX [Salmonella enterica... 664 0.0 ref|NP_458352.1| cell division protein FtsX [Salmonella enterica... 664 0.0 ref|YP_003367768.1| cell division protein [Citrobacter rodentium... 659 0.0 ref|YP_001178572.1| cell division protein FtsX [Enterobacter sp.... 655 0.0 ref|YP_001573000.1| cell division protein FtsX [Salmonella enter... 655 0.0 ref|YP_003615300.1| cell division protein FtsX [Enterobacter clo... 654 0.0 ref|ZP_08500025.1| cell division protein FtsX [Enterobacter horm... 652 0.0 ref|YP_003939844.1| protein insertion ABC transporter, inner mem... 645 0.0 emb|CBK86150.1| cell division protein FtsX [Enterobacter cloacae... 640 0.0 ref|ZP_05969812.2| ABC transporter, FtsX cell division permease ... 634 5e-180 ref|YP_004591311.1| cell division ABC transporter subunit FtsX [... 633 1e-179 ref|YP_002236167.1| cell division protein FtsX [Klebsiella pneum... 629 3e-178 ref|YP_002921670.1| cell division protein FtsX [Klebsiella pneum... 604 7e-171 ref|ZP_06013769.1| cell division protein FtsX [Klebsiella pneumo... 603 1e-170 ref|YP_001337482.1| cell division protein FtsX [Klebsiella pneum... 602 3e-170 gb|EDA93279.1| hypothetical protein GOS_1910702 [marine metagenome] 585 6e-165 gb|EGL74480.1| cell division ABC transporter subunit FtsX [Crono... 558 5e-157 ref|ZP_03086214.1| cell division protein FtsX [Escherichia coli ... 558 7e-157 ref|YP_001440291.1| cell division protein FtsX [Cronobacter saka... 557 1e-156 ref|YP_003212334.1| cell division ABC transporter subunit FtsX [... 540 2e-151 ref|YP_003743628.1| cell division protein [Erwinia billingiae Eb... 495 6e-138 ref|YP_004214911.1| protein insertion ABC transporter inner memb... 479 3e-133 ref|YP_003297369.1| cell division protein [Edwardsiella tarda EI... 476 2e-132 ref|ZP_07952998.1| cell division transport system permease [Ente... 476 3e-132 ref|YP_002935066.1| cell division protein FtsX [Edwardsiella ict... 474 7e-132 ref|YP_004296426.1| cell division protein FtsX [Yersinia enteroc... 473 2e-131 ref|YP_001909182.1| cell division protein FtsX [Erwinia tasmanie... 473 2e-131 ref|NP_667756.1| cell division protein FtsX [Yersinia pestis KIM... 473 3e-131 ref|ZP_06716413.1| ABC transporter, FtsX cell division permease ... 472 3e-131 ref|YP_002650467.1| cell division protein FtsX [Erwinia pyrifoli... 472 5e-131 emb|CAY76124.1| Cell division protein ftsX homolog [Erwinia pyri... 471 6e-131 gb|ADP10649.1| cell division protein FtsX [Erwinia sp. Ejp617] 471 6e-131 ref|YP_003880909.1| putative transporter membrane protein [Dicke... 465 4e-129 ref|YP_003335573.1| protein insertion ABC transporter inner memb... 463 2e-128 ref|ZP_06638258.1| cell division protein FtsX [Serratia odorifer... 461 6e-128 ref|ZP_04633199.1| Cell division protein ftsX [Yersinia frederik... 461 7e-128 ref|ZP_04641494.1| Cell division protein ftsX [Yersinia mollaret... 459 3e-127 ref|ZP_04612213.1| Cell division protein ftsX [Yersinia rohdei A... 458 7e-127 ref|YP_001004613.1| cell division protein FtsX [Yersinia enteroc... 457 9e-127 ref|ZP_04616584.1| Cell division protein ftsX [Yersinia ruckeri ... 457 1e-126 ref|ZP_04624606.1| Cell division protein ftsX [Yersinia kristens... 456 2e-126 ref|ZP_04628424.1| Cell division protein ftsX [Yersinia bercovie... 456 2e-126 ref|YP_003006340.1| cell division protein FtsX [Dickeya zeae Ech... 456 3e-126 ref|ZP_04637167.1| Cell division protein ftsX [Yersinia intermed... 455 5e-126 ref|YP_001476461.1| cell division protein FtsX [Serratia proteam... 454 1e-125 ref|ZP_02959525.1| hypothetical protein PROSTU_01388 [Providenci... 448 8e-124 ref|YP_004498649.1| protein insertion ABC transporter inner memb... 446 2e-123 ref|YP_453766.1| cell division protein FtsX [Sodalis glossinidiu... 444 8e-123 emb|CBX82396.1| Cell division protein ftsX homolog [Erwinia amyl... 444 1e-122 ref|YP_004114140.1| protein insertion ABC transporter inner memb... 444 2e-122 ref|YP_003015699.1| protein insertion ABC transporter, inner mem... 443 2e-122 ref|ZP_07379754.1| protein insertion ABC transporter, inner memb... 443 2e-122 ref|YP_003932607.1| cell division membrane protein ftsX [Pantoea... 442 3e-122 ref|ZP_03833309.1| cell division protein FtsX [Pectobacterium ca... 441 8e-122 ref|YP_003540354.1| cell division protein [Erwinia amylovora ATC... 440 1e-121 ref|YP_003532847.1| cell division protein FtsX [Erwinia amylovor... 440 2e-121 ref|ZP_03827502.1| cell division protein FtsX [Pectobacterium ca... 439 4e-121 dbj|BAK13027.1| cell division protein FtsX [Pantoea ananatis AJ1... 436 4e-120 ref|ZP_04620797.1| Cell division protein ftsX [Yersinia aldovae ... 435 5e-120 ref|ZP_06192556.1| cell division protein FtsX [Serratia odorifer... 434 9e-120 ref|ZP_05972608.1| cell division protein FtsX [Providencia rusti... 434 1e-119 ref|YP_002989450.1| cell division protein FtsX [Dickeya dadantii... 433 2e-119 ref|ZP_08039037.1| putative transporter subunit: membrane compon... 432 3e-119 ref|YP_052431.1| cell division protein FtsX [Pectobacterium atro... 432 4e-119 ref|NP_931294.1| cell division protein FtsX [Photorhabdus lumine... 432 6e-119 ref|ZP_03319146.1| hypothetical protein PROVALCAL_02087 [Provide... 426 3e-117 ref|YP_003257570.1| cell division protein FtsX [Pectobacterium w... 426 4e-117 ref|ZP_06125021.1| ABC transporter, FtsX cell division permease ... 424 1e-116 ref|YP_003710963.1| integral membrane cell division protein [Xen... 421 7e-116 ref|YP_003522018.1| FtsX [Pantoea ananatis LMG 20103] >gb|ADD788... 419 4e-115 ref|ZP_07395825.1| cell division protein with membrane component... 416 2e-114 ref|YP_003042557.1| cell division protein FtsX [Photorhabdus asy... 415 5e-114 ref|YP_003466495.1| integral membrane cell division protein [Xen... 392 5e-107 ref|ZP_03804912.1| hypothetical protein PROPEN_03299 [Proteus pe... 390 1e-106 ref|ZP_03842688.1| cell division protein [Proteus mirabilis ATCC... 389 4e-106 ref|YP_002153282.1| cell division protein FtsX [Proteus mirabili... 388 1e-105 gb|ECC95026.1| hypothetical protein GOS_5370434 [marine metagenome] 385 7e-105 emb|CBA75291.1| cell division protein [Arsenophonus nasoniae] 384 1e-104 ref|ZP_06936195.1| cell division protein FtsX [Escherichia coli ... 365 6e-99 ref|YP_002924992.1| cell division protein for septal ring assimb... 339 4e-91 ref|ZP_03337118.1| cell division protein FtsX [Salmonella enteri... 338 7e-91 ref|ZP_07539180.1| Cell division protein ftsX [Actinobacillus pl... 292 5e-77 ref|ZP_00134414.2| COG2177: Cell division protein [Actinobacillu... 292 6e-77 ref|ZP_08066615.1| cell division protein FtsX [Actinobacillus ur... 291 1e-76 ref|ZP_05921164.1| cell division protein FtsX [Pasteurella dagma... 291 1e-76 ref|ZP_04753444.1| cell division protein FtsX [Actinobacillus mi... 290 2e-76 ref|NP_246460.1| cell division protein FtsX [Pasteurella multoci... 290 4e-76 ref|YP_003008083.1| cell division protein FtsX [Aggregatibacter ... 288 7e-76 ref|ZP_03611910.1| cell division protein FtsX [Actinobacillus mi... 288 7e-76 ref|ZP_06635963.1| putative protein insertion permease FtsX [Agg... 288 1e-75 ref|ZP_07890316.1| cell division protein FtsX [Aggregatibacter s... 287 3e-75 ref|ZP_04978771.1| cell division protein FtsX [Mannheimia haemol... 285 6e-75 ref|YP_003254994.1| cell division protein FtsX [Aggregatibacter ... 285 8e-75 ref|ZP_01794041.1| cell division protein [Haemophilus influenzae... 283 3e-74 ref|NP_438929.1| cell division protein FtsX [Haemophilus influen... 283 3e-74 ref|ZP_08147608.1| cell division protein FtsX [Haemophilus parai... 283 4e-74 emb|CBW29088.1| predicted transporter subunit: membrane componen... 282 6e-74 ref|YP_001343701.1| cell division protein FtsX [Actinobacillus s... 282 6e-74 gb|ADO96935.1| Cell-division ATP transporter, permease protein F... 282 8e-74 ref|ZP_05849381.1| cell division protein [Haemophilus influenzae... 281 9e-74 ref|ZP_01787858.1| cell division protein [Haemophilus influenzae... 281 1e-73 ref|YP_248478.1| cell division protein FtsX [Haemophilus influen... 281 1e-73 ref|ZP_01784143.1| cell division protein [Haemophilus influenzae... 281 1e-73 ref|ZP_01786295.1| cell division protein [Haemophilus influenzae... 281 1e-73 emb|CBW14794.1| predicted transporter subunit: membrane componen... 281 2e-73 ref|ZP_08251352.1| cell division protein FtsX [Haemophilus aegyp... 280 2e-73 ref|YP_001291340.1| cell division protein FtsX [Haemophilus infl... 280 4e-73 ref|ZP_04465928.1| cell division protein FtsX [Haemophilus influ... 280 4e-73 ref|YP_588536.1| cell division protein FtsX [Baumannia cicadelli... 278 9e-73 ref|YP_004137779.1| cell division protein FtsX [Haemophilus infl... 277 2e-72 gb|AAU36614.1| FtsX protein [Mannheimia succiniciproducens MBEL55E] 277 2e-72 ref|YP_087199.2| cell division protein FtsX [Mannheimia succinic... 276 3e-72 ref|NP_873472.1| cell division protein FtsX [Haemophilus ducreyi... 275 6e-72 ref|YP_004420107.1| cell division protein FtsX [Gallibacterium a... 269 6e-70 ref|ZP_02479173.1| membrane component of ABC transporter FtsEX [... 260 2e-67 ref|ZP_06940477.1| cell division protein FtsX [Escherichia coli ... 258 1e-66 ref|YP_719758.1| cell division protein FtsX [Haemophilus somnus ... 255 8e-66 ref|YP_001783817.1| cell division protein FtsX [Haemophilus somn... 255 1e-65 ref|ZP_06535654.1| cell division protein FtsX [Salmonella enteri... 250 2e-64 ref|ZP_03369126.1| cell division protein FtsX [Salmonella enteri... 236 6e-60 ref|ZP_03368578.1| cell division protein FtsX [Salmonella enteri... 230 2e-58 ref|YP_128395.1| cell division protein FtsX [Photobacterium prof... 227 3e-57 ref|ZP_01220726.1| hypothetical cell division protein FtsX [Phot... 222 7e-56 ref|YP_205834.1| ABC transporter membrane protein [Vibrio fische... 221 2e-55 ref|ZP_01237219.1| hypothetical cell division protein FtsX [Vibr... 220 4e-55 ref|ZP_01162449.1| hypothetical cell division protein FtsX [Phot... 218 9e-55 ref|YP_002264231.1| cell division protein FtsX [Aliivibrio salmo... 214 1e-53 ref|ZP_03367765.1| cell division protein FtsX [Salmonella enteri... 214 2e-53 ref|ZP_03372916.1| cell division protein FtsX [Salmonella enteri... 208 9e-52 ref|ZP_06051403.1| cell division protein FtsX [Grimontia hollisa... 207 3e-51 ref|ZP_05942580.1| cell division protein FtsX [Vibrio orientalis... 205 8e-51 ref|YP_003811181.1| Cell division protein FtsX [gamma proteobact... 205 1e-50 ref|ZP_06156575.1| cell division protein FtsX [Photobacterium da... 204 2e-50 ref|YP_154620.1| cell division protein FtsX [Idiomarina loihiens... 202 8e-50 ref|ZP_08098068.1| cell division protein FtsX [Vibrio brasiliens... 202 1e-49 ref|ZP_08622288.1| cell division protein [Idiomarina sp. A28L] >... 201 1e-49 ref|ZP_06534806.1| cell division protein FtsX [Salmonella enteri... 201 2e-49 ref|ZP_08310830.1| permease family protein [Photobacterium leiog... 200 4e-49 ref|ZP_07744107.1| cell division protein FtsX [Vibrio caribbenth... 199 8e-49 ref|YP_003071930.1| cell division protein FtsX [Teredinibacter t... 199 8e-49 ref|ZP_01133076.1| cell division protein [Pseudoalteromonas tuni... 198 1e-48 ref|NP_799333.1| cell division protein FtsX [Vibrio parahaemolyt... 196 7e-48 ref|ZP_01223231.1| putative protein insertion permease FtsX [mar... 195 1e-47 ref|ZP_02197279.1| cell division protein FtsX [Vibrio sp. AND4] ... 194 1e-47 ref|ZP_01896127.1| Cell division protein [Marinobacter algicola ... 194 2e-47 gb|EBQ27571.1| hypothetical protein GOS_7775601 [marine metagenome] 194 2e-47 ref|ZP_08407645.1| cell division protein FtsX [Pseudoalteromonas... 193 3e-47 ref|ZP_01306365.1| Cell division protein [Oceanobacter sp. RED65... 193 4e-47 ref|ZP_05120910.1| cell division protein [Vibrio parahaemolyticu... 192 8e-47 ref|YP_431902.1| cell division protein [Hahella chejuensis KCTC ... 192 1e-46 ref|YP_748978.1| hypothetical protein Sfri_0277 [Shewanella frig... 191 1e-46 ref|ZP_05924445.1| cell division protein FtsX [Vibrio sp. RC341]... 191 2e-46 ref|ZP_06081438.1| cell division protein FtsX [Vibrio sp. RC586]... 191 2e-46 ref|ZP_01041893.1| Cell division protein FtsX [Idiomarina baltic... 190 3e-46 ref|YP_003554964.1| cell division permease protein FtsX [Shewane... 190 4e-46 ref|YP_004483345.1| hypothetical protein Mar181_3410 [Marinomona... 189 6e-46 ref|YP_338897.1| cell division protein [Pseudoalteromonas halopl... 189 7e-46 ref|ZP_01987755.1| cell division protein FtsX [Vibrio harveyi HY... 189 9e-46 ref|YP_929338.1| cell division ABC transporter permease FtsX [Sh... 188 1e-45 ref|ZP_05880564.1| cell division protein FtsX [Vibrio metschniko... 188 1e-45 gb|EDH59905.1| hypothetical protein GOS_576507 [marine metagenome] 188 1e-45 ref|NP_760102.1| cell division protein FtsX [Vibrio vulnificus C... 188 2e-45 ref|ZP_06175872.1| conserved hypothetical protein [Vibrio harvey... 187 2e-45 ref|NP_747210.1| hypothetical protein PP_5109 [Pseudomonas putid... 187 2e-45 ref|YP_003915029.1| cell division protein FtsX [Ferrimonas balea... 187 3e-45 ref|YP_001270286.1| hypothetical protein Pput_4982 [Pseudomonas ... 186 4e-45 gb|ADR62451.1| Hypothetical protein, conserved [Pseudomonas puti... 186 4e-45 ref|YP_001758599.1| hypothetical protein Swoo_0203 [Shewanella w... 186 4e-45 ref|YP_004069797.1| cell division protein [Pseudoalteromonas sp.... 186 6e-45 ref|YP_002314014.1| cell division ABC transporter permease FtsX ... 186 6e-45 ref|ZP_08103068.1| cell division protein FtsX [Vibrio sinaloensi... 186 7e-45 ref|YP_266928.1| putative cell division permease FtsX [Colwellia... 186 8e-45 ref|YP_004564740.1| FtsX [Vibrio anguillarum 775] >gb|AEH31698.1... 185 1e-44 ref|YP_606081.1| cell division protein FtsX [Pseudomonas entomop... 184 1e-44 ref|ZP_01949665.1| cell division protein FtsX [Vibrio cholerae 1... 184 2e-44 ref|YP_564501.1| hypothetical protein Sden_3503 [Shewanella deni... 184 3e-44 ref|ZP_01215539.1| cell division ABC transporter, permease prote... 183 3e-44 ref|ZP_06031439.1| cell division protein FtsX [Vibrio mimicus VM... 183 3e-44 ref|YP_001143659.1| cell division membrane protein FtsX [Aeromon... 183 3e-44 ref|YP_942077.1| cell division ABC transporter component permeas... 183 3e-44 ref|ZP_05717839.1| cell division protein FtsX [Vibrio mimicus VM... 183 4e-44 ref|ZP_04409490.1| cell division protein FtsX [Vibrio cholerae T... 183 4e-44 ref|ZP_04414447.1| cell division protein FtsX [Vibrio cholerae b... 183 5e-44 ref|NP_229807.1| cell division protein FtsX [Vibrio cholerae O1 ... 183 5e-44 dbj|BAA83807.1| cell division protein FtsX [Pseudomonas putida] 182 6e-44 ref|YP_001503823.1| hypothetical protein Spea_3978 [Shewanella p... 182 7e-44 ref|YP_001671379.1| hypothetical protein PputGB1_5159 [Pseudomon... 182 8e-44 ref|ZP_01815121.1| cell division protein [Vibrionales bacterium ... 182 8e-44 ref|YP_001672524.1| hypothetical protein Shal_0289 [Shewanella h... 181 1e-43 ref|ZP_03372187.1| cell division protein FtsX [Salmonella enteri... 181 1e-43 ref|YP_663500.1| hypothetical protein Patl_3946 [Pseudoalteromon... 181 2e-43 ref|YP_003444828.1| hypothetical protein Alvin_2891 [Allochromat... 181 2e-43 ref|YP_112674.1| protein insertion permease FtsX [Methylococcus ... 181 2e-43 ref|ZP_00992285.1| Cell division protein [Vibrio splendidus 12B0... 180 3e-43 gb|ECV07753.1| hypothetical protein GOS_2965525 [marine metagenome] 180 3e-43 ref|YP_871594.1| cell division protein FtsX [Shewanella sp. ANA-... 180 4e-43 gb|AAK20882.1|AF334761_3 cell division membrane protein [Aeromon... 179 4e-43 gb|ECV03597.1| hypothetical protein GOS_2973122 [marine metagenome] 179 5e-43 ref|ZP_01066498.1| Cell division protein [Vibrio sp. MED222] >gb... 179 6e-43 ref|YP_854902.1| cell division membrane protein [Aeromonas hydro... 179 6e-43 ref|YP_001471962.1| hypothetical protein Ssed_0221 [Shewanella s... 179 7e-43 ref|ZP_07654763.1| protein of unknown function DUF214 [Methyloba... 179 8e-43 gb|EBD25364.1| hypothetical protein GOS_9959405 [marine metagenome] 179 9e-43 ref|YP_735892.1| cell division protein FtsX [Shewanella sp. MR-4... 179 9e-43 ref|YP_004394334.1| cell division membrane protein FtsX [Aeromon... 179 9e-43 ref|NP_720100.1| cell division ABC transporter, permease protein... 178 1e-42 ref|ZP_01614886.1| cell division protein [Alteromonadales bacter... 177 2e-42 ref|YP_739879.1| cell division protein FtsX [Shewanella sp. MR-7... 177 2e-42 ref|YP_002418537.1| cell division protein FtxX [Vibrio splendidu... 177 2e-42 ref|ZP_05062532.1| cell division protein [gamma proteobacterium ... 177 2e-42 ref|ZP_01615753.1| Cell division protein [marine gamma proteobac... 177 3e-42 ref|YP_004315067.1| hypothetical protein Marme_4023 [Marinomonas... 176 4e-42 ref|YP_001345865.1| cell division protein FtsX [Pseudomonas aeru... 176 5e-42 ref|YP_001368341.1| hypothetical protein Shew185_4162 [Shewanell... 176 5e-42 ref|YP_002515047.1| protein of unknown function DUF214 [Thioalka... 176 5e-42 ref|NP_249066.1| cell division protein FtsX [Pseudomonas aerugin... 176 6e-42 ref|YP_001556711.1| hypothetical protein Sbal195_4293 [Shewanell... 176 6e-42 ref|ZP_08486996.1| protein of unknown function DUF214 [Methylomi... 176 7e-42 ref|YP_004469180.1| cell division protein [Alteromonas sp. SN2] ... 175 1e-41 ref|ZP_08518652.1| cell division membrane protein FtsX [Aeromona... 175 1e-41 ref|YP_001048576.1| hypothetical protein Sbal_0173 [Shewanella b... 175 1e-41 ref|YP_001747231.1| hypothetical protein PputW619_0356 [Pseudomo... 174 1e-41 ref|YP_004428634.1| cell division protein [Alteromonas macleodii... 174 1e-41 ref|ZP_08568410.1| cell division protein FtsX [Shewanella sp. HN... 174 1e-41 ref|ZP_08330804.1| Cell division protein FtsX [gamma proteobacte... 174 2e-41 gb|EGH57343.1| hypothetical protein PMA4326_00740 [Pseudomonas s... 174 2e-41 gb|EBF60812.1| hypothetical protein GOS_9570059 [marine metagenome] 174 2e-41 ref|YP_001983951.1| cell division protein FtsX [Cellvibrio japon... 174 2e-41 ref|ZP_02002723.1| protein of unknown function DUF214 [Beggiatoa... 173 4e-41 ref|YP_001095729.1| hypothetical protein Shew_3604 [Shewanella l... 173 5e-41 ref|YP_004514020.1| hypothetical protein Metme_3146 [Methylomona... 172 6e-41 ref|YP_004356842.1| cell division-related membrane protein [Pseu... 172 7e-41 ref|YP_003620015.1| cell division transport system permease prot... 172 8e-41 ref|YP_004382283.1| cell division protein FtsX [Pseudomonas mend... 172 8e-41 ref|YP_125027.1| hypothetical protein lpp2722 [Legionella pneumo... 172 8e-41 ref|YP_575031.1| cell division protein FtsX [Chromohalobacter sa... 172 9e-41 ref|ZP_01261836.1| cell division protein FtsX [Vibrio alginolyti... 172 9e-41 ref|YP_096673.1| cell division ATP transporter FtsX [Legionella ... 171 1e-40 ref|YP_127923.1| hypothetical protein lpl2595 [Legionella pneumo... 171 1e-40 ref|YP_004472259.1| protein of unknown function DUF214 [Pseudomo... 171 1e-40 ref|ZP_04923523.1| efflux ABC transporter, permease protein [Vib... 171 2e-40 ref|YP_001174455.1| cell division ABC efflux transporter, permea... 171 2e-40 gb|EDB46734.1| hypothetical protein GOS_1819301 [marine metagenome] 171 2e-40 ref|ZP_04715347.1| cell division protein [Alteromonas macleodii ... 171 2e-40 ref|YP_001249804.1| cell division ATP transporter FtsX [Legionel... 170 3e-40 ref|YP_961000.1| hypothetical protein Maqu_3744 [Marinobacter aq... 170 3e-40 ref|YP_002894186.1| hypothetical protein Tola_3011 [Tolumonas au... 170 4e-40 ref|YP_003898902.1| ABC transporter permease [Halomonas elongata... 169 5e-40 ref|ZP_01898072.1| Cell division protein FtsX [Moritella sp. PE3... 169 5e-40 ref|ZP_04590814.1| hypothetical protein POR16_26294 [Pseudomonas... 169 6e-40 ref|ZP_08571556.1| cell division protein [Rheinheimera sp. A13L]... 169 7e-40 gb|EGH71017.1| hypothetical protein PSYAR_10684 [Pseudomonas syr... 168 1e-39 ref|YP_965269.1| hypothetical protein Sputw3181_3911 [Shewanella... 168 1e-39 ref|ZP_07252715.1| putative protein insertion permease FtsX [Pse... 168 1e-39 gb|EGH08848.1| putative protein insertion permease FtsX [Pseudom... 168 1e-39 ref|ZP_05876515.1| cell division protein FtsX [Vibrio furnissii ... 168 1e-39 gb|EGH23995.1| putative protein insertion permease FtsX [Pseudom... 167 2e-39 ref|YP_276879.1| protein insertion permease FtsX [Pseudomonas sy... 167 2e-39 ref|ZP_06457608.1| putative protein insertion permease FtsX [Pse... 167 2e-39 ref|ZP_03395944.1| insertion permease FtsX protein [Pseudomonas ... 167 2e-39 gb|EGH65701.1| putative protein insertion permease FtsX [Pseudom... 167 2e-39 ref|ZP_02156040.1| cell division ABC transporter, permease prote... 167 2e-39 ref|YP_237814.1| hypothetical protein Psyr_4749 [Pseudomonas syr... 167 3e-39 ref|YP_747736.1| hypothetical protein Neut_1527 [Nitrosomonas eu... 167 3e-39 ref|NP_790278.1| putative protein insertion permease FtsX [Pseud... 166 4e-39 ref|ZP_08489850.1| protein of unknown function DUF214 [Acidithio... 166 5e-39 ref|YP_004436129.1| hypothetical protein Glaag_3935 [Glaciecola ... 166 5e-39 ref|ZP_01077064.1| Cell division protein FtsX [Marinomonas sp. M... 166 6e-39 ref|YP_001189652.1| cell division protein FtsX [Pseudomonas mend... 166 8e-39 gb|EGH55238.1| hypothetical protein PSYCIT7_27200 [Pseudomonas s... 165 9e-39 gb|EBQ12076.1| hypothetical protein GOS_7800021 [marine metagenome] 165 1e-38 ref|ZP_01869754.1| cell division protein FtsX [Vibrio shilonii A... 165 1e-38 ref|YP_413419.1| hypothetical protein Nmul_A2740 [Nitrosospira m... 165 1e-38 ref|ZP_03560216.1| cell division protein [Glaciecola sp. HTCC2999] 165 1e-38 ref|YP_001343156.1| hypothetical protein Mmwyl1_4326 [Marinomona... 164 2e-38 ref|ZP_05111382.1| cell division ATP transporter FtsX [Legionell... 164 2e-38 ref|ZP_06493333.1| hypothetical protein PsyrpsF_04310 [Pseudomon... 163 4e-38 ref|ZP_08553489.1| cell division transport system permease prote... 162 7e-38 ref|YP_003147744.1| hypothetical protein Kkor_2568 [Kangiella ko... 162 7e-38 ref|YP_351063.1| cell division protein FtsX [Pseudomonas fluores... 162 8e-38 gb|ECZ93583.1| hypothetical protein GOS_2093418 [marine metagenome] 161 1e-37 ref|ZP_08141531.1| hypothetical protein G1E_19780 [Pseudomonas s... 161 2e-37 ref|YP_002220779.1| hypothetical protein Lferr_2371 [Acidithioba... 160 2e-37 ref|YP_002801887.1| Cell division protein FtsX [Azotobacter vine... 160 3e-37 ref|YP_003524985.1| hypothetical protein Slit_2371 [Sideroxydans... 160 4e-37 ref|ZP_05042707.1| efflux ABC transporter, permease protein [Alc... 159 1e-36 ref|YP_262913.1| cell division ABC efflux transporter, permease ... 158 1e-36 ref|ZP_01993049.1| cell division protein FtsX [Vibrio parahaemol... 157 2e-36 gb|EDA83631.1| hypothetical protein GOS_1928431 [marine metagenome] 157 2e-36 gb|ADP99252.1| cell division protein FtsX-like protein [Marinoba... 157 2e-36 ref|YP_002875268.1| putative cell division-related membrane prot... 157 3e-36 gb|ECZ91047.1| hypothetical protein GOS_2098117 [marine metagenome] 157 4e-36 ref|ZP_01735525.1| Cell division protein [Marinobacter sp. ELB17... 157 4e-36 gb|EDA72975.1| hypothetical protein GOS_1947993 [marine metagenome] 155 8e-36 gb|EBJ18499.1| hypothetical protein GOS_8966473 [marine metagenome] 155 8e-36 ref|ZP_01165409.1| hypothetical cell division protein FtsX [Ocea... 155 1e-35 gb|ECL30625.1| hypothetical protein GOS_3920334 [marine metagenome] 155 1e-35 ref|ZP_06186671.1| putative cell division protein FtsX [Legionel... 155 1e-35 gb|EDA22549.1| hypothetical protein GOS_2040593 [marine metagenome] 155 1e-35 ref|ZP_07778118.1| cell division transport system permease prote... 154 2e-35 ref|YP_743491.1| cell division protein FtsX [Alkalilimnicola ehr... 154 3e-35 gb|EBS39598.1| hypothetical protein GOS_7443978 [marine metagenome] 153 3e-35 ref|YP_694288.1| cell division protein FtsX [Alcanivorax borkume... 152 7e-35 ref|ZP_05103768.1| efflux ABC transporter, permease protein [Met... 152 7e-35 gb|EBG28514.1| hypothetical protein GOS_9458763 [marine metagenome] 152 9e-35 ref|YP_004295963.1| hypothetical protein NAL212_3019 [Nitrosomon... 152 1e-34 gb|EBH33493.1| hypothetical protein GOS_9280313 [marine metagenome] 151 1e-34 gb|EDI56947.1| hypothetical protein GOS_410444 [marine metagenome] 151 2e-34 gb|EBY88425.1| hypothetical protein GOS_4060006 [marine metagenome] 151 2e-34 ref|ZP_01625599.1| cell division protein FtsX [marine gamma prot... 150 5e-34 ref|YP_001423639.2| cell division protein [Coxiella burnetii Dug... 148 1e-33 ref|YP_002304487.1| cell division protein [Coxiella burnetii Cbu... 148 2e-33 ref|YP_002302619.1| cell division protein [Coxiella burnetii Cbu... 147 3e-33 ref|NP_820882.2| efflux ABC transporter, permease protein [Coxie... 147 3e-33 ref|YP_003846267.1| hypothetical protein Galf_0459 [Gallionella ... 147 3e-33 ref|ZP_01796440.1| membrane component of ABC transporter FtsEX [... 147 4e-33 gb|EBS32544.1| hypothetical protein GOS_7455231 [marine metagenome] 146 5e-33 ref|ZP_08536443.1| cell division protein [Methylophaga aminisulf... 145 9e-33 gb|EDE30710.1| hypothetical protein GOS_1153387 [marine metagenome] 143 5e-32 ref|ZP_01126563.1| Cell division protein [Nitrococcus mobilis Nb... 143 5e-32 gb|EBP75496.1| hypothetical protein GOS_7859872 [marine metagenome] 143 6e-32 gb|EBL14983.1| hypothetical protein GOS_8615602 [marine metagenome] 142 7e-32 ref|YP_365683.1| cell division protein FtsX [Xanthomonas campest... 142 9e-32 ref|ZP_08133946.1| cell division protein FtsX [Kingella denitrif... 141 1e-31 ref|ZP_03337119.1| cell division protein FtsX [Salmonella enteri... 140 3e-31 gb|EDJ03246.1| hypothetical protein GOS_1766413 [marine metagenome] 140 3e-31 ref|ZP_04959185.1| cell division protein [gamma proteobacterium ... 140 4e-31 ref|YP_529062.1| cell division protein FtsX [Saccharophagus degr... 140 4e-31 ref|ZP_01947358.1| efflux ABC transporter, permease protein [Cox... 140 5e-31 ref|ZP_08185852.1| cell division protein FtsX [Xanthomonas gardn... 139 6e-31 ref|YP_001003868.1| hypothetical protein Hhal_2303 [Halorhodospi... 139 9e-31 ref|YP_001597724.1| efflux ABC transporter, permease protein [Co... 139 1e-30 gb|ECK57199.1| hypothetical protein GOS_3340496 [marine metagenome] 138 2e-30 gb|EBV87140.1| hypothetical protein GOS_6837601 [marine metagenome] 138 2e-30 gb|EBK49214.1| hypothetical protein GOS_8723755 [marine metagenome] 137 2e-30 gb|ECW49359.1| hypothetical protein GOS_2711673 [marine metagenome] 137 2e-30 ref|ZP_01103180.1| cell division protein FtsX [Congregibacter li... 137 2e-30 ref|ZP_06705127.1| cell division protein [Xanthomonas fuscans su... 137 2e-30 ref|ZP_06733266.1| cell division protein FtsX [Neisseria elongat... 137 3e-30 ref|NP_841454.1| hypothetical protein NE1413 [Nitrosomonas europ... 137 3e-30 ref|NP_644133.1| cell division protein [Xanthomonas axonopodis p... 137 4e-30 ref|ZP_05095872.1| efflux ABC transporter, permease protein [mar... 137 4e-30 ref|YP_001101141.1| permease [Herminiimonas arsenicoxydans] >emb... 136 5e-30 ref|YP_202938.1| cell division protein [Xanthomonas oryzae pv. o... 136 6e-30 ref|ZP_02241654.1| cell division protein [Xanthomonas oryzae pv.... 136 6e-30 ref|ZP_06492462.1| cell division protein [Xanthomonas campestris... 135 8e-30 ref|ZP_06754382.1| cell division protein FtsX [Simonsiella muell... 135 8e-30 ref|ZP_08189969.1| cell division protein FtsX [Xanthomonas perfo... 135 2e-29 ref|YP_004040329.1| hypothetical protein MPQ_1940 [Methylovorus ... 134 2e-29 ref|YP_002794236.1| FtsX [Laribacter hongkongensis HLHK9] >gb|AC... 134 2e-29 ref|ZP_06486419.1| cell division protein [Xanthomonas campestris... 134 3e-29 ref|ZP_05292747.1| Cell division protein FtsX [Acidithiobacillus... 133 5e-29 ref|ZP_03366355.1| cell division protein FtsX [Salmonella enteri... 133 5e-29 ref|YP_003377349.1| ABC transporter permease [Xanthomonas albili... 132 8e-29 ref|YP_003051694.1| hypothetical protein Msip34_1925 [Methylovor... 132 1e-28 ref|ZP_08176174.1| cell division protein FtsX [Xanthomonas vesic... 132 1e-28 ref|YP_157776.1| cell division protein FtsX [Aromatoleum aromati... 131 2e-28 ref|YP_544840.1| cell division protein FtsX [Methylobacillus fla... 130 2e-28 ref|YP_003049185.1| hypothetical protein Mmol_1754 [Methylotener... 130 3e-28 ref|ZP_04758787.1| ABC transporter, FtsX cell division permease ... 130 3e-28 ref|ZP_05984180.1| ABC transporter, FtsX cell division permease ... 130 3e-28 ref|NP_639119.1| cell division protein [Xanthomonas campestris p... 130 3e-28 ref|ZP_03719984.1| hypothetical protein NEIFLAOT_01836 [Neisseri... 130 4e-28 ref|YP_932272.1| putative cell division protein FtsX [Azoarcus s... 130 5e-28 ref|YP_001354831.1| cell division protein FtsX [Janthinobacteriu... 130 5e-28 gb|EDA72903.1| hypothetical protein GOS_1948161 [marine metagenome] 130 5e-28 ref|ZP_05081692.1| conserved hypothetical protein, putative [bet... 129 9e-28 ref|YP_003674997.1| hypothetical protein M301_2048 [Methylotener... 129 1e-27 ref|ZP_05135515.1| cell division protein [Stenotrophomonas sp. S... 129 1e-27 ref|YP_004147832.1| hypothetical protein Psesu_2774 [Pseudoxanth... 128 2e-27 ref|YP_001973932.1| putative cell division protein [Stenotrophom... 127 2e-27 gb|ECJ96597.1| hypothetical protein GOS_5737326 [marine metagenome] 127 2e-27 ref|ZP_03713950.1| hypothetical protein EIKCOROL_01644 [Eikenell... 127 3e-27 ref|ZP_03700351.1| protein of unknown function DUF214 [Lutiella ... 127 4e-27 ref|YP_002030054.1| hypothetical protein Smal_3672 [Stenotrophom... 127 4e-27 ref|ZP_08275255.1| Cell division protein FtsX [Oxalobacteraceae ... 127 4e-27 gb|EDJ39412.1| hypothetical protein GOS_1703248 [marine metagenome] 127 4e-27 gb|EDH89089.1| hypothetical protein GOS_523832 [marine metagenome] 126 6e-27 ref|YP_002890584.1| hypothetical protein Tmz1t_3614 [Thauera sp.... 126 6e-27 emb|CBA08558.1| Cell division protein [Neisseria meningitidis al... 125 9e-27 ref|YP_004417552.1| cell division protein [Pusillimonas sp. T7-7... 125 1e-26 ref|ZP_05983155.1| ABC transporter, FtsX cell division permease ... 125 1e-26 ref|ZP_07370862.1| cell division protein FtsX [Neisseria meningi... 125 1e-26 gb|ECB80205.1| hypothetical protein GOS_6429143 [marine metagenome] 125 1e-26 ref|ZP_05127889.1| cell division protein [gamma proteobacterium ... 125 2e-26 ref|ZP_06863210.1| ABC transporter, FtsX cell division permease ... 124 2e-26 ref|ZP_06535234.1| cell division protein FtsX [Salmonella enteri... 124 2e-26 ref|YP_003169188.1| hypothetical protein CAP2UW1_4015 [Candidatu... 124 2e-26 gb|EDC83482.1| hypothetical protein GOS_1406388 [marine metagenome] 124 2e-26 ref|ZP_06538521.1| cell division protein FtsX [Salmonella enteri... 124 3e-26 ref|ZP_04601983.1| hypothetical protein GCWU000324_01457 [Kingel... 124 3e-26 gb|EGC56002.1| cell division protein FtsX [Neisseria meningitidi... 124 4e-26 ref|YP_001598192.1| ABC transporter integral membrane protein [N... 123 4e-26 ref|YP_976056.1| putative ABC transporter integral membrane prot... 123 4e-26 ref|YP_208946.1| hypothetical protein NGO1921 [Neisseria gonorrh... 123 5e-26 ref|YP_002002957.1| Cell division protein ftsX-like protein [Nei... 123 5e-26 ref|ZP_03361948.1| cell division protein FtsX [Salmonella enteri... 123 5e-26 gb|ADZ00567.1| cell division protein FtsX [Neisseria meningitidi... 123 5e-26 emb|CBA06328.1| putative permease protein [Neisseria meningitidi... 123 5e-26 ref|YP_003082257.1| cell division protein FtsX [Neisseria mening... 122 7e-26 ref|ZP_04739612.1| hypothetical protein NgonSK_11038 [Neisseria ... 122 8e-26 ref|YP_902075.1| hypothetical protein Ppro_2411 [Pelobacter prop... 122 9e-26 ref|YP_004129867.1| Cell division protein FtsX [Taylorella equig... 122 9e-26 emb|CAX49000.1| cell division protein FtsX [Neisseria meningitid... 122 1e-25 gb|EBP97137.1| hypothetical protein GOS_7824179 [marine metagenome] 122 1e-25 gb|EGC58011.1| cell division protein FtsX [Neisseria meningitidi... 122 1e-25 gb|EGC50201.1| cell division protein FtsX [Neisseria meningitidi... 121 1e-25 emb|CBX21619.1| unnamed protein product [Neisseria lactamica Y92... 121 2e-25 gb|ECD09647.1| hypothetical protein GOS_4792132 [marine metagenome] 121 2e-25 ref|NP_273074.1| putative cell division protein FtsX [Neisseria ... 121 2e-25 ref|ZP_01551886.1| cell division protein FtsX [Methylophilales b... 121 2e-25 gb|EGC65732.1| cell division protein FtsX [Neisseria meningitidi... 121 2e-25 ref|ZP_05987685.1| ABC transporter, FtsX cell division permease ... 121 2e-25 gb|ECY13423.1| hypothetical protein GOS_2411318 [marine metagenome] 121 2e-25 ref|YP_004049608.1| ABC transporter integral membrane protein [N... 120 3e-25 ref|ZP_06935906.1| cell division protein FtsX [Escherichia coli ... 120 3e-25 ref|NP_903875.1| cell division protein FtsX, ABC transporter int... 120 5e-25 ref|ZP_08246964.1| cell division protein FtsX [Neisseria bacilli... 119 8e-25 ref|ZP_08468186.1| cell division protein FtsX [Kingella kingae A... 119 1e-24 ref|YP_384809.1| cell division protein FtsX [Geobacter metallire... 119 1e-24 ref|YP_314132.1| cell division protein FtsX [Thiobacillus denitr... 118 1e-24 ref|YP_003777526.1| cell division protein FtsX [Herbaspirillum s... 118 2e-24 ref|NP_299971.1| cell division protein [Xylella fastidiosa 9a5c]... 118 2e-24 ref|ZP_08506703.1| Putative cell division protein FtsX [Methylov... 118 2e-24 ref|NP_780226.1| cell division protein [Xylella fastidiosa Temec... 117 4e-24 gb|EBF83014.1| hypothetical protein GOS_9533719 [marine metagenome] 117 4e-24 ref|YP_003798687.1| putative cell division protein FtsX [Candida... 116 5e-24 ref|ZP_00651575.1| Protein of unknown function DUF214 [Xylella f... 116 6e-24 ref|ZP_05318772.1| ABC transporter, FtsX cell division permease ... 116 8e-24 gb|EDJ63141.1| hypothetical protein GOS_1661208 [marine metagenome] 115 8e-24 gb|ECK61157.1| hypothetical protein GOS_3198321 [marine metagenome] 115 8e-24 ref|ZP_08271574.1| Cell division protein FtsX [gamma proteobacte... 115 1e-23 gb|EDC83588.1| hypothetical protein GOS_1406217 [marine metagenome] 115 1e-23 ref|ZP_06981814.1| cell division protein FtsX [Neisseria sp. ora... 115 1e-23 ref|ZP_06603746.1| cell division protein FtsX [Selenomonas noxia... 115 2e-23 ref|ZP_05978572.1| ABC transporter, FtsX cell division permease ... 115 2e-23 ref|YP_002602423.1| FtsX [Desulfobacterium autotrophicum HRM2] >... 114 3e-23 gb|ECP48688.1| hypothetical protein GOS_5901270 [marine metagenome] 114 3e-23 gb|EGC52117.1| cell division protein FtsX [Neisseria meningitidi... 114 4e-23 ref|ZP_04577909.1| predicted protein [Oxalobacter formigenes HOx... 113 5e-23 emb|CBX29131.1| hypothetical protein N47_J01120 [uncultured Desu... 113 5e-23 ref|ZP_04580057.1| predicted protein [Oxalobacter formigenes OXC... 113 6e-23 ref|NP_952824.1| cell division ABC transporter permease FtsX [Ge... 112 7e-23 gb|ECT53870.1| hypothetical protein GOS_5571088 [marine metagenome] 112 8e-23 ref|ZP_01113188.1| Cell division protein [Reinekea sp. MED297] >... 112 1e-22 ref|YP_002538103.1| protein of unknown function DUF214 [Geobacte... 112 1e-22 gb|EBS39607.1| hypothetical protein GOS_7443967 [marine metagenome] 111 2e-22 ref|YP_867498.1| cell division protein FtsX [Magnetococcus sp. M... 110 3e-22 ref|ZP_04659712.1| possible cell division protein FtsX [Selenomo... 110 4e-22 ref|ZP_07396945.1| cell division protein FtsX [Selenomonas sp. o... 110 5e-22 gb|ECW55360.1| hypothetical protein GOS_2700079 [marine metagenome] 109 6e-22 ref|YP_004197898.1| hypothetical protein GM18_1147 [Geobacter sp... 109 7e-22 ref|YP_001952158.1| hypothetical protein Glov_1922 [Geobacter lo... 109 8e-22 ref|YP_286915.1| cell division protein FtsX [Dechloromonas aroma... 108 1e-21 ref|ZP_01667312.1| protein of unknown function DUF214 [Thermosin... 108 2e-21 ref|YP_003641475.1| protein of unknown function DUF214 [Therminc... 108 2e-21 ref|YP_002138103.1| cell division ABC transporter membrane prote... 107 3e-21 ref|YP_003981929.1| cell division protein FtsX [Achromobacter xy... 106 6e-21 ref|YP_003826049.1| protein of unknown function DUF214 [Thermose... 106 7e-21 ref|ZP_05732811.1| cell division protein FtsX [Dialister invisus... 105 9e-21 gb|ECX94032.1| hypothetical protein GOS_2447640 [marine metagenome] 105 1e-20 ref|NP_244468.1| cell-division protein [Bacillus halodurans C-12... 105 1e-20 ref|ZP_07316655.1| putative cell division protein FtsX [Veillone... 104 2e-20 ref|ZP_08194170.1| protein of unknown function DUF214 [Clostridi... 104 2e-20 ref|ZP_05898353.1| cell division ABC transporter, permease prote... 104 2e-20 ref|ZP_07825588.1| putative cell division protein FtsX [Dialiste... 103 3e-20 ref|ZP_07829609.1| putative cell division protein FtsX [Selenomo... 103 4e-20 ref|YP_002507180.1| hypothetical protein Ccel_2906 [Clostridium ... 103 4e-20 ref|ZP_08502629.1| cell division protein FtsX [Centipeda periodo... 103 4e-20 ref|YP_003022782.1| hypothetical protein GM21_2995 [Geobacter sp... 103 5e-20 gb|AEI69122.1| ABC transporter permease [Myxococcus fulvus HW-1] 103 6e-20 ref|ZP_01311527.1| protein of unknown function DUF214 [Desulfuro... 103 6e-20 ref|YP_357089.1| cell division protein [Pelobacter carbinolicus ... 102 8e-20 ref|YP_003842791.1| hypothetical protein Clocel_1272 [Clostridiu... 102 8e-20 gb|ECG54928.1| hypothetical protein GOS_5300769 [marine metagenome] 102 1e-19 ref|YP_001230696.1| hypothetical protein Gura_1933 [Geobacter ur... 101 2e-19 ref|ZP_06385819.1| protein of unknown function DUF214 [Candidatu... 101 2e-19 gb|ECS35117.1| hypothetical protein GOS_5054311 [marine metagenome] 100 3e-19 ref|ZP_07827287.1| putative cell division protein FtsX [Veillone... 100 3e-19 ref|YP_004310378.1| hypothetical protein Clole_3496 [Clostridium... 100 3e-19 ref|ZP_07628057.1| efflux ABC transporter, permease protein [Pre... 100 4e-19 gb|EDH28320.1| hypothetical protein GOS_633453 [marine metagenome] 100 4e-19 ref|ZP_06258295.1| efflux ABC transporter, permease protein [Vei... 100 4e-19 ref|YP_003311769.1| hypothetical protein Vpar_0808 [Veillonella ... 100 4e-19 ref|YP_001513790.1| hypothetical protein Clos_2261 [Alkaliphilus... 100 5e-19 ref|YP_002433781.1| hypothetical protein Dalk_4635 [Desulfatibac... 99.4 8e-19 ref|YP_003263423.1| hypothetical protein Hneap_1546 [Halothiobac... 99.4 8e-19 gb|EBQ50316.1| hypothetical protein GOS_7741483 [marine metagenome] 99.0 1e-18 gb|EGO62317.1| hypothetical protein ALO_19122 [Acetonema longum ... 99.0 1e-18 emb|CBE69601.1| putative Cell division protein FtsX [NC10 bacter... 99.0 1e-18 ref|ZP_04599843.1| hypothetical protein VEIDISOL_01286 [Veillone... 98.6 1e-18 ref|YP_004461101.1| hypothetical protein TepRe1_1658 [Tepidanaer... 98.2 2e-18 emb|CBL06247.1| cell division protein FtsX [Megamonas hypermegal... 97.8 2e-18 gb|EFV84831.1| cell division protein [Achromobacter xylosoxidans... 97.8 2e-18 gb|ECO83139.1| hypothetical protein GOS_3900461 [marine metagenome] 97.4 3e-18 ref|ZP_03341931.1| cell division protein FtsX [Salmonella enteri... 97.4 3e-18 ref|ZP_06684554.1| cell division protein [Achromobacter piechaud... 97.4 3e-18 ref|YP_003398367.1| protein of unknown function DUF214 [Acidamin... 97.4 4e-18 ref|NP_623551.1| cell division protein [Thermoanaerobacter tengc... 97.1 4e-18 gb|ECQ92905.1| hypothetical protein GOS_3721751 [marine metagenome] 96.7 6e-18 gb|EDH31854.1| hypothetical protein GOS_627320 [marine metagenome] 96.3 7e-18 ref|YP_787555.1| cell division protein [Bordetella avium 197N] >... 96.3 7e-18 ref|YP_001664564.1| hypothetical protein Teth39_0564 [Thermoanae... 96.3 7e-18 ref|ZP_07132369.1| protein of unknown function DUF214 [Thermoana... 96.3 8e-18 ref|ZP_08075614.1| putative cell division protein FtsX [Phascola... 95.9 9e-18 ref|YP_001321870.1| hypothetical protein Amet_4130 [Alkaliphilus... 95.9 9e-18 gb|EBI53532.1| hypothetical protein GOS_9076357 [marine metagenome] 95.1 2e-17 ref|YP_066290.1| cell division protein (FtsX) [Desulfotalea psyc... 94.7 2e-17 ref|ZP_05404576.1| cell division ABC transporter, permease prote... 94.0 4e-17 gb|EGH80662.1| putative protein insertion permease FtsX [Pseudom... 93.6 4e-17 ref|NP_783033.1| cell division protein ftsX [Clostridium tetani ... 93.6 4e-17 ref|ZP_07053771.1| cell division protein FtsX [Listeria grayi DS... 93.6 5e-17 ref|YP_001114399.1| hypothetical protein Dred_3072 [Desulfotomac... 93.6 5e-17 gb|ECG25002.1| hypothetical protein GOS_3037559 [marine metagenome] 93.6 5e-17 ref|ZP_02920967.1| hypothetical protein STRINF_01851 [Streptococ... 93.2 7e-17 ref|ZP_01976804.1| cell division protein FtsX [Vibrio cholerae B... 93.2 7e-17 ref|YP_003586936.1| cell division protein FtsX [Zunongwangia pro... 93.2 7e-17 ref|YP_001530332.1| hypothetical protein Dole_2451 [Desulfococcu... 93.2 7e-17 ref|YP_004498279.1| hypothetical protein Desca_2543 [Desulfotoma... 92.8 7e-17 ref|YP_001213296.1| cell division protein [Pelotomaculum thermop... 92.8 8e-17 ref|YP_004096555.1| hypothetical protein Bcell_3583 [Bacillus ce... 92.8 8e-17 ref|YP_004462683.1| hypothetical protein Mahau_0658 [Mahella aus... 92.4 9e-17 ref|YP_003677469.1| hypothetical protein Tmath_1757 [Thermoanaer... 92.4 1e-16 ref|YP_001629103.1| hypothetical protein Bpet0500 [Bordetella pe... 92.4 1e-16 ref|ZP_01796441.1| membrane component of ABC transporter FtsEX [... 92.4 1e-16 gb|EDD84358.1| hypothetical protein GOS_1234908 [marine metagenome] 92.4 1e-16 ref|NP_693413.1| cell-division protein [Oceanobacillus iheyensis... 91.7 2e-16 gb|EGH46638.1| putative protein insertion permease FtsX [Pseudom... 91.7 2e-16 ref|YP_003477582.1| hypothetical protein Thit_1776 [Thermoanaero... 91.7 2e-16 gb|EBH80181.1| hypothetical protein GOS_9200151 [marine metagenome] 90.9 3e-16 ref|NP_882331.1| putative permease protein [Bordetella pertussis... 90.9 3e-16 gb|EBW31526.1| hypothetical protein GOS_6766035 [marine metagenome] 90.9 3e-16 ref|ZP_08056841.1| cell-division ABC transporter-like protein [P... 90.5 4e-16 ref|NP_347138.1| cell division protein (ftsX) [Clostridium aceto... 90.5 4e-16 gb|ECK98860.1| hypothetical protein GOS_5151876 [marine metagenome] 90.1 5e-16 ref|YP_001995675.1| hypothetical protein Ctha_0759 [Chloroherpet... 90.1 5e-16 ref|NP_967182.1| hypothetical protein Bd0166 [Bdellovibrio bacte... 89.7 6e-16 ref|ZP_05491516.1| protein of unknown function DUF214 [Thermoana... 89.7 7e-16 ref|YP_001814887.1| hypothetical protein Exig_2420 [Exiguobacter... 89.4 8e-16 ref|ZP_07467031.1| cell division protein FtsX [Streptococcus bov... 89.4 8e-16 ref|YP_002996380.1| putative cell-division protein [Streptococcu... 89.4 9e-16 ref|ZP_05427918.1| cell division protein [Eubacterium saphenum A... 89.0 1e-15 gb|EBV66572.1| hypothetical protein GOS_6869469 [marine metagenome] 89.0 1e-15 ref|YP_003974953.1| cell division protein ftsX [Bacillus atropha... 89.0 1e-15 ref|ZP_08512733.1| cell division protein FtsX [Paenibacillus sp.... 89.0 1e-15 gb|EDD39251.1| hypothetical protein GOS_1312487 [marine metagenome] 89.0 1e-15 ref|YP_002316898.1| cell division protein [Anoxybacillus flavith... 89.0 1e-15 ref|ZP_02993145.1| hypothetical protein CLOSPO_00187 [Clostridiu... 88.6 1e-15 ref|ZP_01914011.1| cell division protein FtsX [Limnobacter sp. M... 88.6 1e-15 ref|ZP_03989383.1| cell division protein [Acidaminococcus sp. D2... 88.6 1e-15 ref|YP_001788719.1| putative cell division protein FtsX [Clostri... 88.6 1e-15 ref|NP_466029.1| hypothetical protein lmo2506 [Listeria monocyto... 88.6 2e-15 ref|YP_002805931.1| putative cell division protein FtsX [Clostri... 88.6 2e-15 ref|ZP_03779796.1| hypothetical protein CLOHYLEM_06876 [Clostrid... 88.6 2e-15 ref|ZP_07464943.1| cell division protein FtsX [Streptococcus gal... 88.2 2e-15 ref|YP_001783027.1| putative cell division protein FtsX [Clostri... 88.2 2e-15 ref|YP_003430913.1| Cell division protein FtsX [Streptococcus ga... 88.2 2e-15 ref|ZP_02616623.1| putative cell division protein FtsX [Clostrid... 88.2 2e-15 gb|EBO42820.1| hypothetical protein GOS_8082053 [marine metagenome] 88.2 2e-15 ref|ZP_07922252.1| cell division protein FtsX [Pseudoramibacter ... 88.2 2e-15 ref|ZP_07328608.1| protein of unknown function DUF214 [Acetivibr... 87.8 2e-15 ref|YP_001255871.1| putative cell division protein FtsX [Clostri... 87.8 2e-15 ref|YP_001392746.1| putative cell division protein FtsX [Clostri... 87.8 2e-15 ref|NP_391405.1| cell-division ABC transporter [Bacillus subtili... 87.8 3e-15 gb|EFY02337.1| Cell division protein ftsX [Streptococcus dysgala... 87.8 3e-15 ref|ZP_01724617.1| cell-division protein [Bacillus sp. B14905] >... 87.8 3e-15 ref|YP_004547110.1| hypothetical protein Desru_3622 [Desulfotoma... 87.8 3e-15 ref|YP_003949048.1| cell division protein [Paenibacillus polymyx... 87.4 3e-15 ref|ZP_07049296.1| cell division protein ftsX-like protein [Lysi... 87.4 3e-15 ref|YP_004205358.1| cell division protein ftsX [Bacillus subtili... 87.4 3e-15 ref|YP_004437537.1| protein of unknown function DUF214 [Thermode... 87.4 3e-15 ref|YP_004470240.1| protein of unknown function DUF214 [Thermoan... 87.4 4e-15 ref|YP_001310070.1| hypothetical protein Cbei_2973 [Clostridium ... 87.4 4e-15 gb|ECS85703.1| hypothetical protein GOS_3056423 [marine metagenome] 87.4 4e-15 ref|YP_003699165.1| hypothetical protein Bsel_1081 [Bacillus sel... 87.4 4e-15 ref|YP_002349070.1| Cell division protein FtsX-like protein [Lis... 87.0 4e-15 ref|YP_015067.1| cell division ABC transporter permease FtsX [Li... 87.0 5e-15 gb|EBQ03248.1| hypothetical protein GOS_7814075 [marine metagenome] 86.7 6e-15 dbj|BAI87152.1| cell-division protein [Bacillus subtilis subsp. ... 86.7 6e-15 ref|ZP_08113136.1| protein of unknown function DUF214 [Desulfoto... 86.3 8e-15 ref|ZP_01996879.1| hypothetical protein DORLON_02904 [Dorea long... 86.3 8e-15 ref|YP_001200981.1| cell division protein [Streptococcus suis 98... 86.3 8e-15 ref|YP_003590007.1| hypothetical protein Btus_2186 [Bacillus tus... 85.9 9e-15 ref|YP_003867799.1| cell division ABC transporter [Bacillus subt... 85.9 1e-14 ref|ZP_07920753.1| cell division protein FtsX [Pseudoramibacter ... 85.9 1e-14 ref|YP_633884.1| ABC transporter permease [Myxococcus xanthus DK... 85.9 1e-14 ref|YP_003872665.1| cell division protein ftsX-like protein [Pae... 85.5 1e-14 gb|EDE47955.1| hypothetical protein GOS_1123648 [marine metagenome] 85.5 1e-14 gb|ECH79860.1| hypothetical protein GOS_3834475 [marine metagenome] 85.5 1e-14 gb|EGJ26031.1| Cell division protein ftsX [Listeria monocytogene... 85.5 1e-14 ref|ZP_06872749.1| cell division protein ftsX [Bacillus subtilis... 85.5 1e-14 gb|EBN08077.1| hypothetical protein GOS_8305151 [marine metagenome] 85.5 1e-14 ref|ZP_07800540.1| efflux ABC transporter, permease protein [Fae... 85.5 1e-14 gb|EDA05305.1| hypothetical protein GOS_2072385 [marine metagenome] 85.5 1e-14 ref|ZP_01461024.1| cell division protein [Stigmatella aurantiaca... 85.1 2e-14 ref|ZP_07726144.1| putative cell division protein FtsX [Streptoc... 85.1 2e-14 ref|ZP_07249333.1| cell division ABC transporter, permease prote... 85.1 2e-14 ref|YP_001679317.1| cell division protein ftsx, putative [Heliob... 85.1 2e-14 gb|ECX34612.1| hypothetical protein GOS_2555103 [marine metagenome] 85.1 2e-14 ref|NP_471979.1| hypothetical protein lin2649 [Listeria innocua ... 85.1 2e-14 ref|ZP_03624888.1| protein of unknown function DUF214 [Streptoco... 85.1 2e-14 ref|YP_850651.1| cell division ABC transporter, permease protein... 85.1 2e-14 ref|YP_003025267.1| cell division protein [Streptococcus suis SC... 84.7 2e-14 gb|EFR92859.1| putative cell division protein [Listeria innocua ... 84.7 2e-14 gb|EFS02128.1| putative cell division protein [Listeria seeliger... 84.7 2e-14 ref|ZP_07823569.1| putative cell division protein FtsX [Streptoc... 84.7 2e-14 ref|NP_661219.1| cell division protein, putative [Chlorobium tep... 84.3 3e-14 ref|YP_001198776.1| cell division protein [Streptococcus suis 05... 84.3 3e-14 gb|EBP52024.1| hypothetical protein GOS_7898243 [marine metagenome] 84.3 3e-14 ref|ZP_08464543.1| cell division protein FtsX [Desmospora sp. 84... 84.3 3e-14 gb|EBR18766.1| hypothetical protein GOS_7640016 [marine metagenome] 84.3 3e-14 ref|YP_003465639.1| cell division ABC transporter, permease prot... 84.3 3e-14 ref|YP_003426051.1| cell-division protein [Bacillus pseudofirmus... 84.3 3e-14 ref|YP_003851266.1| hypothetical protein Tthe_0621 [Thermoanaero... 84.3 3e-14 ref|ZP_08398726.1| putative cell division protein FtsX [Streptoc... 84.0 4e-14 gb|EDI30391.1| hypothetical protein GOS_455668 [marine metagenome] 84.0 4e-14 ref|ZP_06267725.1| efflux ABC transporter, permease protein [Pre... 84.0 4e-14 gb|EBL61202.1| hypothetical protein GOS_8543248 [marine metagenome] 83.6 5e-14 ref|YP_521097.1| hypothetical protein DSY4864 [Desulfitobacteriu... 83.6 5e-14 ref|ZP_02184274.1| cell division ABC transporter, permease prote... 83.6 5e-14 ref|ZP_02235621.1| hypothetical protein DORFOR_02507 [Dorea form... 83.2 6e-14 ref|ZP_08211334.1| protein of unknown function DUF214 [Thermoana... 83.2 6e-14 ref|ZP_07547562.1| protein of unknown function DUF214 [Thermoana... 83.2 6e-14 ref|ZP_07461002.1| cell division protein FtsX [Streptococcus pyo... 83.2 7e-14 ref|YP_059871.1| cell division protein FtsX [Streptococcus pyoge... 83.2 7e-14 gb|EDE33320.1| hypothetical protein GOS_1148788 [marine metagenome] 83.2 7e-14 ref|ZP_07094767.1| efflux ABC transporter, permease protein [Pep... 83.2 7e-14 ref|YP_003572042.1| cell division protein [Salinibacter ruber M8... 83.2 7e-14 ref|YP_001696924.1| cell division protein ftsX-like protein [Lys... 83.2 7e-14 ref|YP_003289921.1| hypothetical protein Rmar_0634 [Rhodothermus... 82.8 7e-14 ref|ZP_03494528.1| protein of unknown function DUF214 [Alicyclob... 82.8 7e-14 ref|YP_002461172.1| hypothetical protein Dhaf_4741 [Desulfitobac... 82.8 7e-14 gb|EBE00294.1| hypothetical protein GOS_9836903 [marine metagenome] 82.8 8e-14 gb|EBP84140.1| hypothetical protein GOS_7845767 [marine metagenome] 82.8 9e-14 ref|YP_004638655.1| hypothetical protein KNP414_00134 [Paenibaci... 82.4 1e-13 ref|ZP_03373172.1| cell division protein FtsX [Salmonella enteri... 82.4 1e-13 gb|ECH49545.1| hypothetical protein GOS_5030049 [marine metagenome] 82.4 1e-13 gb|ECV43401.1| hypothetical protein GOS_2899772 [marine metagenome] 82.4 1e-13 gb|EDE31459.1| hypothetical protein GOS_1152125 [marine metagenome] 82.4 1e-13 gb|EBM79119.1| hypothetical protein GOS_8352592 [marine metagenome] 82.4 1e-13 ref|YP_446064.1| cell division ABC transporter permease FtsX, [S... 82.4 1e-13 ref|ZP_06440143.1| putative permease [Anaerobaculum hydrogenifor... 82.4 1e-13 gb|EGH46265.1| hypothetical protein PSYPI_29744 [Pseudomonas syr... 82.0 1e-13 ref|ZP_06291240.1| cell division protein [Peptoniphilus lacrimal... 82.0 1e-13 ref|YP_001422801.1| hypothetical protein RBAM_032400 [Bacillus a... 82.0 1e-13 ref|YP_001918349.1| protein of unknown function DUF214 [Natranae... 82.0 1e-13 ref|YP_752968.1| hypothetical protein Swol_0246 [Syntrophomonas ... 82.0 1e-13 ref|YP_003475799.1| efflux ABC transporter permease [Clostridial... 82.0 2e-13 ref|YP_003921962.1| cell-division ABC transporter [Bacillus amyl... 82.0 2e-13 ref|YP_003459420.1| hypothetical protein TK90_0168 [Thioalkalivi... 82.0 2e-13 ref|YP_002761673.1| cell division protein FtsX [Gemmatimonas aur... 81.6 2e-13 ref|ZP_07902885.1| hypothetical protein PVOR_31644 [Paenibacillu... 81.6 2e-13 gb|ECX30629.1| hypothetical protein GOS_2562346 [marine metagenome] 81.6 2e-13 gb|ECP20031.1| hypothetical protein GOS_5936655 [marine metagenome] 81.6 2e-13 ref|YP_863046.1| cell division protein FtsX [Gramella forsetii K... 81.6 2e-13 ref|ZP_08051428.1| cell division ABC transporter, permease prote... 81.6 2e-13 gb|AEB65187.1| hypothetical protein LL3_03660 [Bacillus amyloliq... 81.6 2e-13 ref|YP_004374101.1| cell-division ABC transporter [Carnobacteriu... 81.3 2e-13 ref|ZP_06198554.1| cell division ABC transporter, permease prote... 81.3 2e-13 ref|ZP_08282549.1| putative cell division protein FtsX [Paenibac... 81.3 2e-13 ref|ZP_08095138.1| cell division protein ftsX-like protein [Plan... 81.3 2e-13 ref|YP_004518605.1| hypothetical protein Desku_3318 [Desulfotoma... 81.3 2e-13 ref|YP_003183854.1| hypothetical protein Aaci_0406 [Alicyclobaci... 81.3 2e-13 ref|NP_268889.1| putative cell-division protein [Streptococcus p... 81.3 2e-13 ref|YP_002885265.1| hypothetical protein EAT1b_0891 [Exiguobacte... 81.3 3e-13 ref|NP_606879.1| cell-division protein [Streptococcus pyogenes M... 81.3 3e-13 ref|YP_001488383.1| cell division protein FtsX [Bacillus pumilus... 80.9 3e-13 ref|ZP_07643752.1| putative permease [Streptococcus mitis SK321]... 80.9 3e-13 ref|YP_003245853.1| hypothetical protein GYMC10_5841 [Paenibacil... 80.9 3e-13 ref|YP_001887538.1| cell-division protein [Clostridium botulinum... 80.9 3e-13 ref|ZP_05390360.1| protein of unknown function DUF214 [Clostridi... 80.5 4e-13 ref|YP_003396374.1| hypothetical protein Cwoe_4586 [Conexibacter... 80.5 4e-13 ref|YP_003143299.1| cell division protein [Slackia heliotrinired... 80.5 4e-13 ref|YP_004267514.1| hypothetical protein Sgly_3249 [Syntrophobot... 80.5 4e-13 ref|YP_080850.1| cell-division protein [Bacillus licheniformis A... 80.5 4e-13 ref|YP_003446508.1| cell division ABC transporter, permease prot... 80.5 4e-13 ref|ZP_07639041.1| cell division ABC transporter, permease prote... 80.1 5e-13 gb|EBN79720.1| hypothetical protein GOS_8186994 [marine metagenome] 80.1 5e-13 ref|ZP_07821235.1| efflux ABC transporter, permease protein [Pep... 80.1 5e-13 gb|ECM87472.1| hypothetical protein GOS_4664897 [marine metagenome] 80.1 5e-13 ref|ZP_08002143.1| FtsX protein [Bacillus sp. BT1B_CT2] >gb|EFV7... 80.1 5e-13 gb|EDJ09981.1| hypothetical protein GOS_1754988 [marine metagenome] 80.1 6e-13 gb|EBC17280.1| hypothetical protein GOS_112803 [marine metagenome] 80.1 6e-13 gb|ECY64658.1| hypothetical protein GOS_2323349 [marine metagenome] 79.7 6e-13 ref|ZP_08061885.1| cell division protein FtsX [Streptococcus inf... 79.7 6e-13 ref|YP_004626957.1| hypothetical protein Thein_2145 [Thermodesul... 79.7 7e-13 ref|YP_003180293.1| cell division protein FtsX [Atopobium parvul... 79.7 7e-13 ref|ZP_05855152.1| cell-division protein [Blautia hansenii DSM 2... 79.7 7e-13 ref|YP_004579539.1| hypothetical protein Lacal_1263 [Lacinutrix ... 79.7 7e-13 ref|YP_002532695.1| cell division ABC transporter permease ftsx ... 79.7 7e-13 ref|ZP_02424439.1| hypothetical protein ALIPUT_00556 [Alistipes ... 79.7 8e-13 ref|NP_721693.1| putative cell-division protein FtsX [Streptococ... 79.7 8e-13 ref|ZP_03568495.1| cell division protein FtsX [Atopobium rimae A... 79.3 8e-13 ref|ZP_03053899.1| putative Cell division protein FtsX homolog [... 79.3 8e-13 ref|YP_001999313.1| hypothetical protein Cpar_1721 [Chlorobaculu... 79.3 8e-13 ref|ZP_05793148.1| putative cell division ABC transporter, perme... 79.3 9e-13 emb|CBK97857.1| Cell division protein [Faecalibacterium prausnit... 79.3 1e-12 ref|ZP_04863196.1| cell division protein FtsX [Clostridium botul... 79.3 1e-12 ref|YP_806173.1| cell division protein [Lactobacillus casei ATCC... 79.3 1e-12 gb|EDH21662.1| hypothetical protein GOS_645305 [marine metagenome] 79.3 1e-12 gb|AEA53366.1| Cell division protein [Lactobacillus casei LC2W] 79.3 1e-12 ref|YP_001647752.1| hypothetical protein BcerKBAB4_4977 [Bacillu... 79.3 1e-12 ref|ZP_04171462.1| Cell division ABC transporter, permease prote... 79.0 1e-12 gb|EBM35282.1| hypothetical protein GOS_8423531 [marine metagenome] 79.0 1e-12 ref|YP_897373.1| cell division protein FtsX [Bacillus thuringien... 79.0 1e-12 ref|ZP_04823972.1| efflux ABC transporter, permease protein, Fts... 79.0 1e-12 ref|ZP_06611784.1| cell division protein FtsX [Streptococcus ora... 79.0 1e-12 ref|YP_001922479.1| cell-division protein [Clostridium botulinum... 79.0 1e-12 ref|YP_003715671.1| putative cell division protein [Croceibacter... 79.0 1e-12 ref|ZP_02433768.1| hypothetical protein CLOSCI_04053 [Clostridiu... 79.0 1e-12 ref|YP_003193281.1| hypothetical protein Dtox_3965 [Desulfotomac... 79.0 1e-12 gb|ECD11736.1| hypothetical protein GOS_4704739 [marine metagenome] 79.0 1e-12 ref|ZP_05614574.1| putative cell division protein [Faecalibacter... 78.6 1e-12 ref|ZP_04081327.1| Cell division ABC transporter, permease prote... 78.6 1e-12 gb|EDE08239.1| hypothetical protein GOS_1193021 [marine metagenome] 78.6 1e-12 ref|ZP_04853248.1| cell division protein [Paenibacillus sp. oral... 78.6 1e-12 ref|NP_847586.1| cell division ABC transporter, permease protein... 78.6 1e-12 ref|ZP_03734685.1| protein of unknown function DUF214 [Dethiobac... 78.6 2e-12 ref|YP_001130002.1| cell division protein FtsX [Chlorobium phaeo... 78.6 2e-12 emb|CBL14750.1| Cell division protein [Ruminococcus bromii L2-63] 78.6 2e-12 gb|EBJ82609.1| hypothetical protein GOS_8833552 [marine metagenome] 78.6 2e-12 ref|ZP_06286539.1| efflux ABC transporter, permease protein [Pre... 78.6 2e-12 ref|ZP_01287883.1| Protein of unknown function DUF214 [delta pro... 78.6 2e-12 ref|ZP_04303351.1| Cell division ABC transporter, permease prote... 78.2 2e-12 gb|EGL90006.1| efflux ABC transporter, permease protein [Strepto... 78.2 2e-12 ref|ZP_07458935.1| cell division protein FtsX [Streptococcus sp.... 78.2 2e-12 ref|ZP_07400508.1| possible cell division protein FtsX [Peptonip... 78.2 2e-12 ref|YP_001618623.1| hypothetical protein sce7973 [Sorangium cell... 77.8 2e-12 ref|YP_003958716.1| hypothetical protein ELI_0739 [Eubacterium l... 77.8 2e-12 gb|EBV61062.1| hypothetical protein GOS_6878392 [marine metagenome] 77.8 3e-12 ref|ZP_08049150.1| cell division ABC transporter, permease prote... 77.8 3e-12 ref|ZP_07694215.1| cell division ABC transporter, permease prote... 77.8 3e-12 gb|ECT08909.1| hypothetical protein GOS_7094045 [marine metagenome] 77.8 3e-12 ref|YP_001376911.1| hypothetical protein Bcer98_3722 [Bacillus c... 77.8 3e-12 ref|ZP_07887751.1| cell division protein FtsX [Streptococcus san... 77.4 3e-12 ref|NP_981582.1| cell division ABC transporter, permease protein... 77.4 3e-12 ref|YP_004326363.1| cell division ABC transporter, permease prot... 77.4 3e-12 gb|EBC31408.1| hypothetical protein GOS_90302 [marine metagenome] 77.4 3e-12 ref|ZP_02160508.1| putative cell division protein [Kordia algici... 77.4 4e-12 ref|ZP_02420636.1| hypothetical protein ANACAC_03253 [Anaerostip... 77.4 4e-12 ref|ZP_04453762.1| hypothetical protein GCWU000182_03082 [Abiotr... 77.4 4e-12 ref|ZP_01906905.1| cell division ABC transporter, permease prote... 77.4 4e-12 ref|YP_003703190.1| hypothetical protein Slip_1871 [Syntrophothe... 77.0 4e-12 ref|ZP_08549477.1| cell-division associated ABC transporter, mem... 77.0 4e-12 gb|EDH74672.1| hypothetical protein GOS_549365 [marine metagenome] 77.0 4e-12 ref|ZP_08522547.1| efflux ABC transporter, permease protein [Str... 77.0 4e-12 ref|ZP_07389314.1| protein of unknown function DUF214 [Paenibaci... 77.0 4e-12 ref|ZP_03800981.1| hypothetical protein COPCOM_03268 [Coprococcu... 77.0 4e-12 ref|YP_001127133.1| cell division ABC transporter permease FtsX ... 77.0 5e-12 gb|EDE57761.1| hypothetical protein GOS_1106473 [marine metagenome] 77.0 5e-12 ref|ZP_04286805.1| Cell division ABC transporter, permease prote... 77.0 5e-12 ref|ZP_03231197.1| cell division ABC transporter, permease prote... 77.0 5e-12 ref|ZP_03100321.1| cell division ABC transporter, permease prote... 76.6 5e-12 ref|NP_834849.1| cell division protein ftsX [Bacillus cereus ATC... 76.6 5e-12 ref|ZP_06254625.1| putative cell division protein FtsX [Prevotel... 76.6 5e-12 ref|YP_002774765.1| cell division protein FtsX [Brevibacillus br... 76.6 5e-12 gb|EDB55918.1| hypothetical protein GOS_1803010 [marine metagenome] 76.6 6e-12 ref|ZP_03489220.1| hypothetical protein EUBIFOR_01806 [Eubacteri... 76.6 6e-12 ref|ZP_08058840.1| cell division protein FtsX [Streptococcus cri... 76.6 6e-12 ref|ZP_07034360.1| cell division protein FtsX [Prevotella oris C... 76.6 6e-12 ref|YP_001560694.1| hypothetical protein Cphy_3608 [Clostridium ... 76.6 6e-12 ref|ZP_04188755.1| Cell division ABC transporter, permease prote... 76.6 6e-12 gb|ECJ84306.1| hypothetical protein GOS_6240931 [marine metagenome] 76.6 6e-12 ref|ZP_08605495.1| hypothetical protein HMPREF0994_01501 [Lachno... 76.6 6e-12 gb|EBM28364.1| hypothetical protein GOS_8434406 [marine metagenome] 76.6 6e-12 gb|EDE62145.1| hypothetical protein GOS_1098932 [marine metagenome] 76.6 6e-12 gb|EBU42665.1| hypothetical protein GOS_7116292 [marine metagenome] 76.6 7e-12 ref|ZP_00739132.1| Cell division protein ftsX [Bacillus thuringi... 76.3 7e-12 ref|NP_561216.1| cell-division protein [Clostridium perfringens ... 76.3 7e-12 ref|YP_694757.1| putative cell division protein [Clostridium per... 76.3 8e-12 ref|YP_003254225.1| hypothetical protein GYMC61_3188 [Geobacillu... 76.3 8e-12 ref|YP_001716478.1| hypothetical protein Daud_0285 [Candidatus D... 76.3 8e-12 ref|YP_003238473.1| protein of unknown function DUF214 [Ammonife... 76.3 8e-12 ref|ZP_07664425.1| cell division protein FtsX [Atopobium vaginae... 76.3 8e-12 ref|ZP_04142179.1| Cell division ABC transporter, permease prote... 76.3 9e-12 emb|CBK79028.1| cell division protein FtsX [Coprococcus catus GD/7] 75.9 1e-11 ref|ZP_07727504.1| efflux ABC transporter, permease protein [Str... 75.9 1e-11 gb|EBH77849.1| hypothetical protein GOS_9204110 [marine metagenome] 75.9 1e-11 emb|CBK82952.1| cell division protein FtsX [Coprococcus sp. ART5... 75.9 1e-11 ref|ZP_08160797.1| efflux ABC transporter, permease protein [Rum... 75.9 1e-11 gb|EDH91005.1| hypothetical protein GOS_520525 [marine metagenome] 75.9 1e-11 ref|ZP_07710004.1| Cell division protein [Bacillus sp. m3-13] 75.9 1e-11 ref|YP_003960992.1| hypothetical protein ELI_3060 [Eubacterium l... 75.9 1e-11 ref|ZP_08041474.1| cell division protein FtsX [Streptococcus equ... 75.9 1e-11 gb|EBL65388.1| hypothetical protein GOS_8536335 [marine metagenome] 75.5 1e-11 ref|YP_003800162.1| cell division protein FtsX [Olsenella uli DS... 75.5 1e-11 ref|ZP_01062206.1| putative cell division protein [Leeuwenhoekie... 75.5 1e-11 ref|ZP_08063449.1| cell division protein FtsX [Streptococcus par... 75.5 1e-11 ref|ZP_03296820.1| hypothetical protein COLSTE_00705 [Collinsell... 75.5 1e-11 ref|ZP_02866273.1| hypothetical protein CLOSPI_00050 [Clostridiu... 75.5 1e-11 ref|ZP_07642107.1| cell division protein FtsX [Streptococcus mit... 75.5 1e-11 ref|ZP_07645370.1| cell division ABC transporter, permease prote... 75.5 1e-11 gb|ECV02461.1| hypothetical protein GOS_2975498 [marine metagenome] 75.1 2e-11 ref|ZP_04148496.1| Cell division ABC transporter, permease prote... 75.1 2e-11 ref|ZP_02638406.1| putative cell division protein [Clostridium p... 75.1 2e-11 ref|ZP_06253482.1| putative cell division protein FtsX [Prevotel... 75.1 2e-11 ref|YP_001960281.1| hypothetical protein Cphamn1_1883 [Chlorobiu... 75.1 2e-11 ref|ZP_08029872.1| efflux ABC transporter, permease protein [Sol... 75.1 2e-11 ref|YP_004621806.1| cell division protein FtsX [Streptococcus pa... 75.1 2e-11 ref|YP_148953.1| cell-division protein [Geobacillus kaustophilus... 75.1 2e-11 ref|ZP_03758596.1| hypothetical protein CLOSTASPAR_02612 [Clostr... 75.1 2e-11 ref|ZP_08151887.1| hypothetical protein HMPREF0490_02628 [Lachno... 74.7 2e-11 gb|EBO18811.1| hypothetical protein GOS_8121969 [marine metagenome] 74.7 2e-11 ref|ZP_04087183.1| Cell division ABC transporter, permease prote... 74.7 2e-11 ref|ZP_08447746.1| efflux ABC transporter, permease protein [Cap... 74.7 2e-11 emb|CBK95588.1| Cell division protein [Eubacterium siraeum 70/3] 74.7 2e-11 ref|ZP_08065780.1| cell division protein FtsX [Streptococcus per... 74.7 2e-11 ref|ZP_04292056.1| Cell division ABC transporter, permease prote... 74.7 2e-11 ref|YP_004202945.1| cell division protein FtsX [Thermus scotoduc... 74.7 3e-11 gb|EDH37583.1| hypothetical protein GOS_617049 [marine metagenome] 74.7 3e-11 ref|ZP_05132630.1| cell division protein [Clostridium sp. 7_2_43... 74.3 3e-11 ref|YP_003014425.1| hypothetical protein Pjdr2_5733 [Paenibacill... 74.3 3e-11 ref|ZP_04449481.1| hypothetical protein GCWU000282_00710 [Catone... 74.3 3e-11 ref|YP_877354.1| cell division protein ftsX [Clostridium novyi N... 74.3 3e-11 gb|ECW61191.1| hypothetical protein GOS_2689297 [marine metagenome] 74.3 3e-11 ref|ZP_04177149.1| Cell division ABC transporter, permease prote... 74.3 3e-11 ref|ZP_05666466.1| cell division protein [Enterococcus faecium 1... 74.3 3e-11 ref|ZP_04320370.1| Cell division ABC transporter, permease prote... 74.3 3e-11 ref|YP_002448714.1| cell division ABC transporter, permease prot... 74.3 3e-11 ref|ZP_05659536.1| cell division protein [Enterococcus faecium 1... 74.3 3e-11 ref|YP_004568122.1| hypothetical protein BCO26_0677 [Bacillus co... 74.3 3e-11 ref|ZP_07462378.1| cell division protein FtsX [Streptococcus mit... 74.3 3e-11 ref|ZP_05714424.1| cell division ABC transporter, permease prote... 74.3 3e-11 ref|YP_816154.1| cell division ABC transporter permease FtsX [St... 74.3 3e-11 ref|ZP_05662380.1| cell division protein [Enterococcus faecium 1... 74.3 3e-11 ref|YP_002037403.1| Cell division protein FtsX [Streptococcus pn... 74.3 3e-11 ref|ZP_06701375.1| putative cell division protein FtsX [Enteroco... 74.3 3e-11 ref|YP_003778494.1| putative cell division protein [Clostridium ... 74.3 3e-11 ref|YP_004395099.1| cell division protein ftsX [Clostridium botu... 73.9 3e-11 ref|ZP_04430588.1| protein of unknown function DUF214 [Bacillus ... 73.9 3e-11 ref|ZP_03148080.1| protein of unknown function DUF214 [Geobacill... 73.9 3e-11 ref|YP_359040.1| cell division protein FtsX [Carboxydothermus hy... 73.9 3e-11 ref|ZP_03982075.1| cell divison ABC transporter FtsX [Enterococc... 73.9 3e-11 ref|ZP_03783416.1| hypothetical protein RUMHYD_02883 [Blautia hy... 73.9 4e-11 ref|NP_349268.1| cell division protein FtsX [Clostridium acetobu... 73.9 4e-11 ref|ZP_06963294.1| cell division ABC transporter, permease prote... 73.9 4e-11 ref|YP_001835424.1| cell division ABC transporter permease FtsX ... 73.9 4e-11 ref|YP_003150952.1| cell division protein [Cryptobacterium curtu... 73.9 4e-11 ref|YP_002483616.1| hypothetical protein Cyan7425_2914 [Cyanothe... 73.9 4e-11 gb|EGJ18831.1| permease family protein [Streptococcus pneumoniae... 73.9 4e-11 ref|ZP_08201080.1| cell division protein [Capnocytophaga sp. ora... 73.9 4e-11 ref|ZP_07896321.1| cell division protein FtsX [Enterococcus ital... 73.9 4e-11 gb|EBP19823.1| hypothetical protein GOS_7950398 [marine metagenome] 73.6 4e-11 ref|NP_345255.1| cell division ABC transporter permease FtsX [St... 73.6 4e-11 ref|YP_003724482.1| cell division ABC superfamily transporter pe... 73.6 5e-11 ref|ZP_01831253.1| cell division ABC transporter, permease prote... 73.6 5e-11 ref|YP_002742240.1| cell division ABC transporter, permease prot... 73.6 5e-11 ref|ZP_02094386.1| hypothetical protein PEPMIC_01152 [Parvimonas... 73.6 5e-11 ref|NP_358261.1| cell division ABC transporter, permease protein... 73.6 5e-11 gb|EBC31258.1| hypothetical protein GOS_90619 [marine metagenome] 73.6 5e-11 ref|ZP_08135988.1| cell division protein FtsX [Prevotella multif... 73.6 5e-11 gb|EBH28599.1| hypothetical protein GOS_9288780 [marine metagenome] 73.6 5e-11 ref|ZP_08540658.1| efflux ABC transporter, permease protein [Par... 73.6 5e-11 gb|EDH42889.1| hypothetical protein GOS_607549 [marine metagenome] 73.6 5e-11 ref|ZP_04230536.1| Cell division ABC transporter, permease prote... 73.6 5e-11 emb|CBK89111.1| Cell division protein [Eubacterium cylindroides ... 73.6 5e-11 gb|EBK58800.1| hypothetical protein GOS_8707837 [marine metagenome] 73.6 6e-11 ref|YP_002744755.1| cell division protein [Streptococcus equi su... 73.6 6e-11 ref|YP_003862431.1| putative cell division protein [Maribacter s... 73.6 6e-11 ref|ZP_05858145.1| putative cell division protein FtsX [Prevotel... 73.6 6e-11 ref|YP_001917919.1| protein of unknown function DUF214 [Natranae... 73.2 6e-11 ref|ZP_07639184.1| putative cell-division protein [Streptococcus... 73.2 7e-11 ref|ZP_02862209.1| hypothetical protein ANASTE_01422 [Anaerofust... 73.2 7e-11 ref|ZP_04446050.1| hypothetical protein COLINT_02774 [Collinsell... 73.2 7e-11 gb|EBM25046.1| hypothetical protein GOS_8439309 [marine metagenome] 72.8 7e-11 ref|ZP_08171748.1| efflux ABC transporter, permease protein [Pre... 72.8 7e-11 gb|ECL67738.1| hypothetical protein GOS_5939835 [marine metagenome] 72.8 8e-11 gb|EBD93914.1| hypothetical protein GOS_9847562 [marine metagenome] 72.8 8e-11 gb|EBW83556.1| hypothetical protein GOS_6684032 [marine metagenome] 72.8 8e-11 ref|ZP_02620289.1| cell division protein FtsX [Clostridium botul... 72.8 8e-11 gb|ECV24491.1| hypothetical protein GOS_2936533 [marine metagenome] 72.8 8e-11 gb|EBD28682.1| hypothetical protein GOS_9953762 [marine metagenome] 72.8 8e-11 ref|YP_002746122.1| cell division protein [Streptococcus equi su... 72.8 9e-11 ref|ZP_02423219.1| hypothetical protein EUBSIR_02077 [Eubacteriu... 72.8 9e-11 ref|YP_003807732.1| hypothetical protein Deba_1771 [Desulfarculu... 72.8 9e-11 emb|CBL34003.1| Cell division protein [Eubacterium siraeum V10Sc8a] 72.8 9e-11 ref|YP_001038273.1| cell division protein FtsX [Clostridium ther... 72.8 9e-11 ref|YP_003142287.1| cell division protein FtsX [Capnocytophaga o... 72.4 1e-10 ref|ZP_07758028.1| efflux ABC transporter, permease protein [Meg... 72.4 1e-10 ref|ZP_06560348.1| efflux ABC transporter, permease protein [Meg... 72.4 1e-10 gb|ECX67133.1| hypothetical protein GOS_2496864 [marine metagenome] 72.4 1e-10 ref|ZP_03463725.1| hypothetical protein BACPEC_02826 [Bacteroide... 72.4 1e-10 ref|ZP_04219786.1| Cell division ABC transporter, permease prote... 72.4 1e-10 ref|ZP_03729296.1| protein of unknown function DUF214 [Dethiobac... 72.4 1e-10 gb|ECP91330.1| hypothetical protein GOS_4205402 [marine metagenome] 72.4 1e-10 ref|YP_004586519.1| hypothetical protein Geoth_0398 [Geobacillus... 72.4 1e-10 ref|YP_003182348.1| hypothetical protein Elen_1995 [Eggerthella ... 72.0 1e-10 ref|ZP_04159496.1| Cell division ABC transporter, permease prote... 72.0 1e-10 ref|ZP_07322537.1| efflux ABC transporter, permease protein [Pre... 72.0 1e-10 ref|ZP_02080170.1| hypothetical protein CLOLEP_01622 [Clostridiu... 72.0 1e-10 gb|ECS31177.1| hypothetical protein GOS_5210922 [marine metagenome] 72.0 1e-10 ref|YP_003813597.1| efflux ABC transporter, permease protein [Pr... 72.0 1e-10 gb|ECT47944.1| hypothetical protein GOS_5807918 [marine metagenome] 72.0 2e-10 ref|YP_002936635.1| cell division protein [Eubacterium rectale A... 72.0 2e-10 ref|ZP_08525089.1| putative cell division protein FtsX [Streptoc... 72.0 2e-10 ref|ZP_03489217.1| hypothetical protein EUBIFOR_01803 [Eubacteri... 72.0 2e-10 gb|ECA43313.1| hypothetical protein GOS_4878580 [marine metagenome] 72.0 2e-10 ref|ZP_04153791.1| Cell division ABC transporter, permease prote... 72.0 2e-10 ref|YP_004237782.1| hypothetical protein Weevi_0485 [Weeksella v... 72.0 2e-10 ref|ZP_06391291.1| protein of unknown function DUF214 [Dethiosul... 71.6 2e-10 ref|ZP_02949514.1| putative Cell division protein FtsX [Clostrid... 71.6 2e-10 ref|YP_073969.1| cell-division protein [Symbiobacterium thermoph... 71.6 2e-10 ref|ZP_08020850.1| cell division protein FtsX [Streptococcus aus... 71.6 2e-10 ref|ZP_01385155.1| Protein of unknown function DUF214 [Chlorobiu... 71.6 2e-10 ref|YP_003992044.1| hypothetical protein Calhy_0946 [Caldicellul... 71.6 2e-10 emb|CBK89558.1| cell division protein FtsX [Eubacterium rectale ... 71.6 2e-10 ref|ZP_06060785.1| cell division protein FtsX [Streptococcus sp.... 71.6 2e-10 ref|ZP_04857959.1| conserved hypothetical protein [Ruminococcus ... 71.6 2e-10 ref|ZP_03753166.1| hypothetical protein ROSEINA2194_01582 [Roseb... 71.6 2e-10 gb|EDA22662.1| hypothetical protein GOS_2040419 [marine metagenome] 71.6 2e-10 ref|YP_003821043.1| protein of unknown function DUF214 [Clostrid... 71.2 2e-10 dbj|BAK17678.1| cell division protein [Solibacillus silvestris S... 71.2 2e-10 gb|ECR80127.1| hypothetical protein GOS_3744630 [marine metagenome] 71.2 2e-10 ref|YP_004163859.1| cell division protein ftsx [Cellulophaga alg... 71.2 2e-10 gb|EGJ40604.1| cell division protein FtsX [Streptococcus sanguin... 71.2 2e-10 ref|ZP_07961930.1| cell division protein FtsX [Prevotella saliva... 71.2 2e-10 ref|ZP_08579120.1| cell division protein FtsX [Prevotella multis... 71.2 3e-10 gb|EGC22870.1| cell division protein FtsX [Streptococcus sanguin... 71.2 3e-10 ref|NP_735030.1| hypothetical protein gbs0566 [Streptococcus aga... 71.2 3e-10 ref|ZP_01174132.1| cell-division protein [Bacillus sp. NRRL B-14... 70.9 3e-10 ref|ZP_08514410.1| efflux ABC transporter, permease protein [Ali... 70.9 3e-10 ref|ZP_03391858.1| cell division protein FtsX [Capnocytophaga sp... 70.9 3e-10 ref|YP_004372574.1| cell division protein FtsX [Coriobacterium g... 70.9 3e-10 ref|YP_004044700.1| cell division protein ftsx [Riemerella anati... 70.9 3e-10 ref|NP_687549.1| cell division ABC transporter permease FtsX [St... 70.9 3e-10 ref|YP_003987826.1| hypothetical protein GY4MC1_0373 [Geobacillu... 70.9 3e-10 ref|YP_002950940.1| hypothetical protein GWCH70_3003 [Geobacillu... 70.9 4e-10 ref|ZP_03210669.1| Cell division protein [Lactobacillus rhamnosu... 70.9 4e-10 gb|ECP14309.1| hypothetical protein GOS_6171979 [marine metagenome] 70.9 4e-10 ref|ZP_08013812.1| cell division protein FtsX [Streptococcus ang... 70.9 4e-10 ref|ZP_07863706.1| efflux ABC transporter, permease protein [Str... 70.5 4e-10 gb|EBZ24375.1| hypothetical protein GOS_6131532 [marine metagenome] 70.5 4e-10 ref|ZP_06288807.1| efflux ABC transporter, permease protein [Pre... 70.5 4e-10 ref|YP_002473619.1| hypothetical protein CKR_3154 [Clostridium k... 70.5 4e-10 ref|ZP_06408487.1| cell division protein FtsX [Prevotella melani... 70.5 4e-10 gb|EGJ37413.1| cell division protein FtsX [Streptococcus sanguin... 70.5 4e-10 ref|YP_001311929.1| hypothetical protein Cbei_4867 [Clostridium ... 70.5 4e-10 ref|ZP_06405117.1| cell division protein FtsX [Prevotella sp. or... 70.1 5e-10 ref|YP_001396937.1| cell division protein, ftsX-related [Clostri... 70.1 5e-10 ref|ZP_05980464.1| putative cell division protein [Subdoligranul... 70.1 5e-10 ref|ZP_01772372.1| Hypothetical protein COLAER_01376 [Collinsell... 70.1 5e-10 ref|YP_001450719.1| cell division protein FtsX [Streptococcus go... 70.1 5e-10 ref|ZP_08245770.1| efflux ABC transporter, permease protein [Str... 70.1 6e-10 emb|CBK82617.1| cell division protein FtsX [Coprococcus sp. ART5... 70.1 6e-10 gb|EDJ45009.1| hypothetical protein GOS_1693106 [marine metagenome] 70.1 6e-10 gb|EBG48215.1| hypothetical protein GOS_9425781 [marine metagenome] 70.1 6e-10 ref|YP_004052886.1| hypothetical protein Ftrac_0776 [Marivirga t... 70.1 6e-10 ref|ZP_08429582.1| cell division protein FtsX [Lyngbya majuscula... 69.7 6e-10 ref|YP_003996212.1| hypothetical protein Lbys_0063 [Leadbetterel... 69.7 7e-10 ref|YP_003840882.1| hypothetical protein COB47_1613 [Caldicellul... 69.7 7e-10 gb|ECB97239.1| hypothetical protein GOS_5750285 [marine metagenome] 69.7 7e-10 ref|ZP_02090467.1| hypothetical protein FAEPRAM212_00717 [Faecal... 69.7 7e-10 ref|ZP_03683910.1| hypothetical protein CATMIT_02571 [Catenibact... 69.7 7e-10 ref|YP_004026008.1| hypothetical protein Calkr_0872 [Caldicellul... 69.7 7e-10 ref|ZP_04564834.1| conserved hypothetical protein [Mollicutes ba... 69.7 7e-10 gb|ECW37087.1| hypothetical protein GOS_2733010 [marine metagenome] 69.7 8e-10 ref|ZP_06420506.1| cell division protein FtsX [Prevotella buccae... 69.7 8e-10 ref|ZP_08564036.1| cell-division associated ABC superfamily ATP ... 69.7 8e-10 ref|ZP_02427732.1| hypothetical protein CLORAM_01119 [Clostridiu... 69.7 8e-10 ref|YP_004101056.1| hypothetical protein Tmar_0204 [Thermaerobac... 69.3 8e-10 emb|CBL03264.1| Cell division protein [Gordonibacter pamelaeae 7... 69.3 8e-10 ref|ZP_07319727.1| putative cell division protein FtsX [Atopobiu... 69.3 9e-10 gb|ECI08555.1| hypothetical protein GOS_6212854 [marine metagenome] 69.3 9e-10 gb|EBP16622.1| hypothetical protein GOS_7955933 [marine metagenome] 69.3 9e-10 gb|EDF92544.1| hypothetical protein GOS_870626 [marine metagenome] 69.3 9e-10 ref|YP_004002891.1| hypothetical protein Calow_1545 [Caldicellul... 69.3 9e-10 ref|ZP_07454123.1| cell division protein FtsX [Eubacterium yurii... 69.3 1e-09 ref|YP_912419.1| cell division protein FtsX [Chlorobium phaeobac... 69.3 1e-09 gb|EBM89294.1| hypothetical protein GOS_8335677 [marine metagenome] 69.3 1e-09 ref|YP_001957540.1| hypothetical protein Aasi_0390 [Candidatus A... 69.3 1e-09 ref|ZP_06341412.1| efflux ABC transporter, permease protein [Bul... 69.3 1e-09 ref|YP_004171694.1| hypothetical protein Deima_2391 [Deinococcus... 68.9 1e-09 ref|ZP_06423391.1| cell division protein FtsX [Prevotella sp. or... 68.9 1e-09 ref|ZP_08080441.1| cell division protein FtsX [Lactobacillus rum... 68.9 1e-09 ref|YP_176559.1| cell-division protein FtsX [Bacillus clausii KS... 68.9 1e-09 ref|YP_001928689.1| putative cell division protein FtsX [Porphyr... 68.9 1e-09 ref|NP_905676.1| cell division protein FtsX [Porphyromonas gingi... 68.9 1e-09 gb|EDG29250.1| hypothetical protein GOS_807082 [marine metagenome] 68.9 1e-09 gb|EDI44202.1| hypothetical protein GOS_432388 [marine metagenome] 68.9 1e-09 ref|ZP_06159706.1| putative cell division ABC transporter, perme... 68.9 1e-09 gb|EDG83383.1| hypothetical protein GOS_713404 [marine metagenome] 68.9 1e-09 ref|YP_003301572.1| hypothetical protein Tcur_4005 [Thermomonosp... 68.9 1e-09 ref|ZP_08422438.1| protein of unknown function DUF214 [Desulfovi... 68.9 1e-09 emb|CBL28947.1| Cell division protein [Synergistetes bacterium S... 68.9 1e-09 gb|EDJ21456.1| hypothetical protein GOS_1735275 [marine metagenome] 68.9 1e-09 gb|ECF50040.1| hypothetical protein GOS_6005535 [marine metagenome] 68.9 1e-09 ref|YP_004023604.1| hypothetical protein Calkro_0913 [Caldicellu... 68.9 1e-09 gb|EBF16577.1| hypothetical protein GOS_9642216 [marine metagenome] 68.6 1e-09 ref|YP_003831919.1| cell division permease FtsX [Butyrivibrio pr... 68.6 2e-09 ref|YP_004509492.1| cell division protein FtsX [Porphyromonas gi... 68.6 2e-09 ref|YP_002019095.1| protein of unknown function DUF214 [Pelodict... 68.6 2e-09 ref|YP_002573666.1| hypothetical protein Athe_1800 [Caldicellulo... 68.6 2e-09 ref|YP_004261606.1| hypothetical protein Celly_0903 [Cellulophag... 68.6 2e-09 ref|ZP_07720818.1| cell division protein [Algoriphagus sp. PR1] ... 68.6 2e-09 ref|ZP_03227867.1| hypothetical protein Bcoam_18842 [Bacillus co... 68.2 2e-09 ref|YP_001181112.1| hypothetical protein Csac_2343 [Caldicellulo... 68.2 2e-09 ref|ZP_05852438.1| cell division ABC transporter permease FtsX [... 68.2 2e-09 gb|EDG78239.1| hypothetical protein GOS_722323 [marine metagenome] 68.2 2e-09 gb|EDH52933.1| hypothetical protein GOS_589232 [marine metagenome] 68.2 2e-09 gb|EBS73042.1| hypothetical protein GOS_7389888 [marine metagenome] 68.2 2e-09 ref|YP_429123.1| cell division protein FtsX [Moorella thermoacet... 68.2 2e-09 ref|YP_002561964.1| cell division protein [Streptococcus uberis ... 68.2 2e-09 gb|EDH19218.1| hypothetical protein GOS_649805 [marine metagenome] 68.2 2e-09 ref|YP_139597.1| cell division ABC transporter permease [Strepto... 67.8 2e-09 ref|YP_003600225.1| cell division ABC transporter permease FtsX ... 67.8 2e-09 ref|ZP_02026206.1| hypothetical protein EUBVEN_01462 [Eubacteriu... 67.8 2e-09 gb|ECK81859.1| hypothetical protein GOS_5851800 [marine metagenome] 67.8 3e-09 ref|YP_001157836.1| hypothetical protein Strop_0983 [Salinispora... 67.8 3e-09 ref|ZP_01253990.1| cell division protein FtsX [Psychroflexus tor... 67.8 3e-09 ref|YP_003834163.1| hypothetical protein Micau_1024 [Micromonosp... 67.8 3e-09 ref|YP_003095448.1| cell division protein ftsX [Flavobacteriacea... 67.4 3e-09 ref|YP_003408352.1| hypothetical protein Gobs_1235 [Geodermatoph... 67.4 4e-09 ref|YP_002123099.1| cell division protein FtsX [Streptococcus eq... 67.4 4e-09 ref|YP_003565501.1| cell division ABC transporter permease FtsX ... 67.4 4e-09 ref|ZP_08047403.1| cell division ABC transporter, permease prote... 67.4 4e-09 ref|ZP_04607735.1| hypothetical protein MCAG_03992 [Micromonospo... 67.4 4e-09 ref|YP_141507.1| cell division ABC transporter permease [Strepto... 67.4 4e-09 ref|YP_820489.1| cell division ABC transporter, permease [Strept... 67.4 4e-09 gb|ECZ11624.1| hypothetical protein GOS_2239132 [marine metagenome] 67.4 4e-09 ref|YP_290533.1| cell division protein FtsX [Thermobifida fusca ... 67.4 4e-09 ref|ZP_06644500.1| cell division ABC transporter, permease prote... 67.0 4e-09 gb|EDC17140.1| hypothetical protein GOS_1523480 [marine metagenome] 67.0 4e-09 gb|EDF79546.1| hypothetical protein GOS_892845 [marine metagenome] 67.0 4e-09 ref|ZP_02076723.1| hypothetical protein EUBDOL_00514 [Eubacteriu... 67.0 4e-09 ref|ZP_08340985.1| hypothetical protein HMPREF9477_01628 [Lachno... 67.0 5e-09 ref|YP_002016370.1| hypothetical protein Paes_1705 [Prosthecochl... 67.0 5e-09 ref|ZP_07834811.1| putative cell division protein FtsX [Clostrid... 67.0 5e-09 ref|ZP_08533094.1| protein of unknown function DUF214 [Caldalkal... 67.0 5e-09 ref|ZP_07672641.1| cell division ABC transporter, permease prote... 67.0 5e-09 ref|YP_004194435.1| hypothetical protein Despr_0970 [Desulfobulb... 67.0 5e-09 ref|ZP_06982984.1| cell division protein FtsX [Bacteroidetes ora... 67.0 5e-09 emb|CBL21148.1| cell division protein FtsX [Ruminococcus sp. SR1/5] 66.6 5e-09 ref|ZP_08069615.1| cell division protein FtsX [Streptococcus ves... 66.6 6e-09 gb|ECI85572.1| hypothetical protein GOS_3153943 [marine metagenome] 66.6 6e-09 ref|YP_003085657.1| hypothetical protein Dfer_1243 [Dyadobacter ... 66.6 6e-09 ref|YP_395110.1| cell-division associated ABC transporter, membr... 66.6 6e-09 emb|CBL17148.1| Cell division protein [Ruminococcus sp. 18P13] 66.6 6e-09 ref|ZP_04667127.1| conserved hypothetical protein [Clostridiales... 66.6 6e-09 emb|CBL25714.1| cell division protein FtsX [Ruminococcus torques... 66.6 7e-09 gb|EBN03289.1| hypothetical protein GOS_8312791 [marine metagenome] 66.6 7e-09 gb|EBR12746.1| hypothetical protein GOS_7648908 [marine metagenome] 66.2 7e-09 gb|EBV06900.1| hypothetical protein GOS_6961185 [marine metagenome] 66.2 7e-09 gb|AEI51128.1| protein of unknown function DUF214 [Runella slith... 66.2 7e-09 gb|EDC41209.1| hypothetical protein GOS_1480606 [marine metagenome] 66.2 8e-09 ref|ZP_02691783.1| hypothetical protein Epulo_01471 [Epulopisciu... 66.2 9e-09 ref|ZP_06267213.1| efflux ABC transporter, permease protein [Pyr... 66.2 9e-09 ref|YP_004090474.1| protein of unknown function DUF214 [Ethanoli... 66.2 9e-09 emb|CBL23521.1| cell division protein FtsX [Ruminococcus obeum A... 66.2 9e-09 ref|ZP_08090996.1| cell division protein FtsX [Clostridium symbi... 66.2 9e-09 ref|YP_644379.1| cell division protein FtsX [Rubrobacter xylanop... 66.2 9e-09 gb|EBO76690.1| hypothetical protein GOS_8023993 [marine metagenome] 66.2 9e-09 ref|YP_003937109.1| cell-division protein [Clostridium stickland... 66.2 9e-09 ref|ZP_04058222.1| cell division protein FtsX [Capnocytophaga gi... 66.2 9e-09 ref|ZP_06142843.1| cell division protein [Ruminococcus flavefaci... 65.9 9e-09 ref|ZP_00683788.1| Protein of unknown function DUF214 [Xylella f... 65.9 1e-08 gb|EDJ30911.1| hypothetical protein GOS_1718349 [marine metagenome] 65.9 1e-08 gb|EBR14198.1| hypothetical protein GOS_7646732 [marine metagenome] 65.9 1e-08 ref|ZP_08616435.1| hypothetical protein HMPREF0988_02020 [Lachno... 65.9 1e-08 gb|EBH16159.1| hypothetical protein GOS_9310158 [marine metagenome] 65.9 1e-08 gb|ECS91693.1| hypothetical protein GOS_8932038 [marine metagenome] 65.9 1e-08 ref|ZP_08084663.1| cell division protein FtsX [Prevotella oralis... 65.9 1e-08 gb|ECW40806.1| hypothetical protein GOS_2726651 [marine metagenome] 65.5 1e-08 ref|ZP_01201088.1| cell division permease, FtsX [Flavobacteria b... 65.5 1e-08 gb|ECF51534.1| hypothetical protein GOS_5947558 [marine metagenome] 65.5 1e-08 ref|ZP_02865043.1| putative cell division protein [Clostridium p... 65.5 1e-08 gb|EBP11056.1| hypothetical protein GOS_7965440 [marine metagenome] 65.5 1e-08 ref|ZP_07723092.1| efflux ABC transporter, permease protein [Str... 65.5 1e-08 gb|EDE20395.1| hypothetical protein GOS_1171671 [marine metagenome] 65.5 1e-08 ref|ZP_07739352.1| cell division protein FtsX [Aminomonas pauciv... 65.5 2e-08 ref|YP_003249989.1| Cell division protein-like protein [Fibrobac... 65.1 2e-08 gb|EDI98204.1| hypothetical protein GOS_1775191 [marine metagenome] 65.1 2e-08 ref|ZP_08015134.1| hypothetical protein HMPREF9464_00353 [Sutter... 65.1 2e-08 gb|EBG28907.1| hypothetical protein GOS_9458113 [marine metagenome] 65.1 2e-08 ref|YP_697621.1| cell division protein [Clostridium perfringens ... 65.1 2e-08 gb|EBC83916.1| hypothetical protein GOS_6165 [marine metagenome] 65.1 2e-08 ref|ZP_01688048.1| efflux ABC transporter, permease protein [Mic... 65.1 2e-08 ref|ZP_06708206.1| cell division protein [Streptomyces sp. e14] ... 65.1 2e-08 gb|ECD08908.1| hypothetical protein GOS_4823244 [marine metagenome] 65.1 2e-08 ref|YP_004105851.1| hypothetical protein Rumal_2748 [Ruminococcu... 65.1 2e-08 dbj|BAE97619.1| cell division protein [Agromyces sp. KY5R] 65.1 2e-08 gb|EBC03442.1| hypothetical protein GOS_135090 [marine metagenome] 65.1 2e-08 ref|ZP_04455615.1| hypothetical protein GCWU000342_01642 [Shuttl... 64.7 2e-08 ref|YP_144335.1| cell division protein FtsX [Thermus thermophilu... 64.7 2e-08 ref|NP_267129.1| cell division protein [Lactococcus lactis subsp... 64.7 2e-08 ref|ZP_04062086.1| cell division protein [Streptococcus salivari... 64.7 2e-08 ref|ZP_02076720.1| hypothetical protein EUBDOL_00511 [Eubacteriu... 64.7 2e-08 gb|ADZ63588.1| cell division transport system permease protein [... 64.7 2e-08 ref|ZP_01049789.2| cell division protein FtsX [Dokdonia donghaen... 64.7 2e-08 ref|YP_062285.1| cell division protein [Leifsonia xyli subsp. xy... 64.7 2e-08 ref|YP_003510656.1| hypothetical protein Snas_1867 [Stackebrandt... 64.7 2e-08 ref|ZP_06345037.1| putative cell division ABC transporter, perme... 64.7 2e-08 ref|ZP_02037846.1| hypothetical protein BACCAP_03465 [Bacteroide... 64.7 3e-08 gb|EDF91468.1| hypothetical protein GOS_872509 [marine metagenome] 64.3 3e-08 gb|EBJ63031.1| hypothetical protein GOS_8866302 [marine metagenome] 64.3 3e-08 ref|ZP_02075655.1| hypothetical protein CLOL250_02431 [Clostridi... 64.3 3e-08 ref|ZP_02083205.1| hypothetical protein CLOBOL_00721 [Clostridiu... 64.3 3e-08 ref|YP_004430509.1| protein of unknown function DUF214 [Krokinob... 64.3 3e-08 gb|EDH74974.1| hypothetical protein GOS_548829 [marine metagenome] 64.3 3e-08 ref|YP_004456189.1| cell division protein FtsX [Melissococcus pl... 64.3 3e-08 ref|ZP_06006035.2| cell division protein FtsX [Prevotella bergen... 64.3 3e-08 ref|ZP_04741925.1| cell division protein FtsX [Roseburia intesti... 64.3 3e-08 gb|EDC84795.1| hypothetical protein GOS_1404064 [marine metagenome] 64.3 3e-08 gb|ECV88233.1| hypothetical protein GOS_2818580 [marine metagenome] 64.3 3e-08 emb|CBK77136.1| cell division protein FtsX [Clostridium cf. sacc... 64.3 3e-08 ref|YP_003684825.1| hypothetical protein Mesil_1424 [Meiothermus... 63.9 4e-08 ref|ZP_01891271.1| cell division protein FtsX [unidentified euba... 63.9 4e-08 ref|YP_478098.1| permease [Synechococcus sp. JA-2-3B'a(2-13)] >g... 63.9 4e-08 gb|ECW30401.1| hypothetical protein GOS_2744961 [marine metagenome] 63.9 4e-08 ref|ZP_01861770.1| cell division ABC transporter, permease prote... 63.9 4e-08 ref|ZP_08286238.1| cell division protein [Streptomyces griseoaur... 63.9 4e-08 ref|ZP_05393316.1| protein of unknown function DUF214 [Clostridi... 63.5 5e-08 gb|EBN29901.1| hypothetical protein GOS_8269447 [marine metagenome] 63.5 5e-08 gb|EDI15964.1| hypothetical protein GOS_478473 [marine metagenome] 63.5 5e-08 ref|ZP_07836992.1| protein of unknown function DUF214 [Thermaero... 63.5 5e-08 ref|YP_677568.1| cell division protein FtsX [Cytophaga hutchinso... 63.5 5e-08 ref|ZP_08128594.1| cell division protein FtsX [Clostridium sp. D... 63.5 5e-08 gb|ECC70129.1| hypothetical protein GOS_6368897 [marine metagenome] 63.5 6e-08 ref|ZP_03706344.1| hypothetical protein CLOSTMETH_01077 [Clostri... 63.5 6e-08 gb|EDC55573.1| hypothetical protein GOS_1455567 [marine metagenome] 63.5 6e-08 gb|EDE11262.1| hypothetical protein GOS_1187675 [marine metagenome] 63.2 6e-08 gb|EDE98122.1| hypothetical protein GOS_1036283 [marine metagenome] 63.2 6e-08 ref|YP_003110347.1| protein of unknown function DUF214 [Acidimic... 63.2 6e-08 ref|ZP_01117414.1| putative cell division protein [Polaribacter ... 63.2 6e-08 ref|ZP_02033665.1| hypothetical protein PARMER_03700 [Parabacter... 63.2 6e-08 gb|ECW57330.1| hypothetical protein GOS_2696404 [marine metagenome] 63.2 6e-08 ref|YP_002951451.1| hypothetical membrane protein [Desulfovibrio... 63.2 7e-08 gb|EDI17243.1| hypothetical protein GOS_476138 [marine metagenome] 63.2 7e-08 ref|YP_003690513.1| protein of unknown function DUF214 [Desulfur... 63.2 7e-08 ref|YP_001512217.1| hypothetical protein Clos_0661 [Alkaliphilus... 63.2 7e-08 gb|EBO37141.1| hypothetical protein GOS_8091613 [marine metagenome] 63.2 7e-08 ref|YP_004368397.1| protein of unknown function DUF214 [Marinith... 63.2 7e-08 ref|YP_003782982.1| cell division protein [Corynebacterium pseud... 63.2 7e-08 gb|EDH23133.1| hypothetical protein GOS_642693 [marine metagenome] 63.2 7e-08 ref|YP_002906721.1| cell division protein FtsX [Corynebacterium ... 63.2 7e-08 gb|EDH60411.1| hypothetical protein GOS_575578 [marine metagenome] 62.8 8e-08 gb|EBR88146.1| hypothetical protein GOS_7526237 [marine metagenome] 62.8 8e-08 gb|EDB34651.1| hypothetical protein GOS_1839774 [marine metagenome] 62.8 9e-08 ref|YP_002309105.1| cell division protein FtsX [Candidatus Azoba... 62.8 9e-08 gb|EDJ15907.1| hypothetical protein GOS_1744712 [marine metagenome] 62.8 1e-07 ref|ZP_03013494.1| hypothetical protein BACINT_01053 [Bacteroide... 62.8 1e-07 ref|YP_001535827.1| hypothetical protein Sare_0919 [Salinispora ... 62.8 1e-07 gb|ECU03379.1| hypothetical protein GOS_3605383 [marine metagenome] 62.8 1e-07 gb|ECF24755.1| hypothetical protein GOS_3490999 [marine metagenome] 62.8 1e-07 gb|EDI58236.1| hypothetical protein GOS_408386 [marine metagenome] 62.8 1e-07 ref|ZP_07881155.1| cell division protein [Actinomyces sp. oral t... 62.8 1e-07 gb|EDH86112.1| hypothetical protein GOS_529184 [marine metagenome] 62.4 1e-07 gb|EBF23083.1| hypothetical protein GOS_9631758 [marine metagenome] 62.4 1e-07 ref|YP_003353456.1| cell division permease FtsX [Lactococcus lac... 62.4 1e-07 gb|EBO65526.1| hypothetical protein GOS_8043526 [marine metagenome] 62.4 1e-07 gb|EBR89651.1| hypothetical protein GOS_7523791 [marine metagenome] 62.4 1e-07 gb|ECV34505.1| hypothetical protein GOS_2916861 [marine metagenome] 62.4 1e-07 gb|EBI49878.1| hypothetical protein GOS_9082431 [marine metagenome] 62.4 1e-07 ref|ZP_05736787.1| cell division ABC superfamily ATP binding cas... 62.4 1e-07 ref|YP_002488453.1| hypothetical protein Achl_2399 [Arthrobacter... 62.0 1e-07 ref|YP_004403679.1| hypothetical protein VAB18032_09805 [Verruco... 62.0 1e-07 gb|ECX10260.1| hypothetical protein GOS_2598728 [marine metagenome] 62.0 1e-07 gb|EBE22373.1| hypothetical protein GOS_9799682 [marine metagenome] 62.0 1e-07 gb|EBF11444.1| hypothetical protein GOS_9650487 [marine metagenome] 62.0 1e-07 gb|EBJ67377.1| hypothetical protein GOS_8859117 [marine metagenome] 62.0 1e-07 ref|ZP_03476851.1| hypothetical protein PRABACTJOHN_02525 [Parab... 62.0 1e-07 ref|ZP_00365539.1| COG2177: Cell division protein [Streptococcus... 62.0 1e-07 ref|ZP_03677770.1| hypothetical protein BACCELL_02108 [Bacteroid... 62.0 2e-07 ref|YP_004272655.1| protein of unknown function DUF214 [Pedobact... 62.0 2e-07 gb|ECV80284.1| hypothetical protein GOS_2832663 [marine metagenome] 62.0 2e-07 ref|YP_473646.1| permease [Synechococcus sp. JA-3-3Ab] >gb|ABC98... 62.0 2e-07 gb|EBC07342.1| hypothetical protein GOS_128600 [marine metagenome] 62.0 2e-07 ref|ZP_05004979.1| cell division protein [Streptomyces clavulige... 62.0 2e-07 gb|EDD92815.1| hypothetical protein GOS_1220318 [marine metagenome] 61.6 2e-07 ref|ZP_02441718.1| hypothetical protein ANACOL_00999 [Anaerotrun... 61.6 2e-07 gb|ECJ41458.1| hypothetical protein GOS_4413745 [marine metagenome] 61.6 2e-07 gb|EBZ75526.1| hypothetical protein GOS_4082671 [marine metagenome] 61.6 2e-07 ref|ZP_05916234.1| cell division protein FtsX [Prevotella sp. or... 61.6 2e-07 gb|EDC80154.1| hypothetical protein GOS_1412021 [marine metagenome] 61.6 2e-07 ref|YP_004241795.1| cell division protein FtsX [Arthrobacter phe... 61.6 2e-07 gb|ECB71654.1| hypothetical protein GOS_3283591 [marine metagenome] 61.6 2e-07 gb|ECN76885.1| hypothetical protein GOS_4601967 [marine metagenome] 61.6 2e-07 gb|EBV82725.1| hypothetical protein GOS_6844534 [marine metagenome] 61.6 2e-07 ref|YP_832143.1| cell division protein FtsX [Arthrobacter sp. FB... 61.2 2e-07 gb|ECJ90552.1| hypothetical protein GOS_5989743 [marine metagenome] 61.2 2e-07 ref|ZP_07016517.1| protein of unknown function DUF214 [Desulfona... 61.2 2e-07 ref|ZP_03291814.1| hypothetical protein CLONEX_04046 [Clostridiu... 61.2 2e-07 ref|ZP_02437679.1| hypothetical protein CLOSS21_00110 [Clostridi... 61.2 2e-07 ref|ZP_08027604.1| cell division protein FtsX [Actinomyces sp. o... 61.2 2e-07 gb|ECV87325.1| hypothetical protein GOS_2820212 [marine metagenome] 61.2 2e-07 gb|ECS80109.1| hypothetical protein GOS_3275783 [marine metagenome] 61.2 3e-07 ref|ZP_06644503.1| cell division ABC transporter, permease prote... 61.2 3e-07 ref|NP_787328.1| cell division protein FtsX [Tropheryma whipplei... 61.2 3e-07 emb|CBL41587.1| cell division protein FtsX [butyrate-producing b... 61.2 3e-07 ref|ZP_07088762.1| probable cell division protein [Chryseobacter... 61.2 3e-07 ref|ZP_08418436.1| putative cell division protein FtsX [Ruminoco... 60.8 3e-07 gb|EDB64896.1| hypothetical protein GOS_1618850 [marine metagenome] 60.8 3e-07 ref|ZP_05647143.1| cell division protein [Enterococcus casselifl... 60.8 3e-07 ref|ZP_06263011.1| efflux ABC transporter, permease protein [Pro... 60.8 3e-07 gb|EDA98288.1| hypothetical protein GOS_1901751 [marine metagenome] 60.8 3e-07 ref|NP_789500.1| cell division protein FtsX [Tropheryma whipplei... 60.8 3e-07 ref|YP_003496580.1| cell division transport system permease prot... 60.8 3e-07 gb|ECW30067.1| hypothetical protein GOS_2745607 [marine metagenome] 60.8 3e-07 ref|YP_386611.1| cell division protein FtsX [Desulfovibrio desul... 60.8 3e-07 emb|CBL37738.1| cell division protein FtsX [butyrate-producing b... 60.8 3e-07 ref|ZP_01053556.1| cell division protein FtsX [Polaribacter sp. ... 60.8 3e-07 gb|EDD74285.1| hypothetical protein GOS_1252386 [marine metagenome] 60.8 3e-07 gb|EBG05355.1| hypothetical protein GOS_9497444 [marine metagenome] 60.8 3e-07 ref|YP_056063.1| cell division protein [Propionibacterium acnes ... 60.8 3e-07 ref|NP_295273.1| ftsE protein [Deinococcus radiodurans R1] >gb|A... 60.8 3e-07 ref|YP_001103364.1| putative cell division membrane protein [Sac... 60.8 3e-07 gb|EGC25116.1| cell division protein FtsX [Streptococcus sanguin... 60.8 4e-07 ref|YP_001034847.1| cell division protein FtsX [Streptococcus sa... 60.8 4e-07 gb|EBI75395.1| hypothetical protein GOS_9039283 [marine metagenome] 60.8 4e-07 gb|ECZ14752.1| hypothetical protein GOS_2233676 [marine metagenome] 60.8 4e-07 ref|YP_809018.1| cell division protein FtsX [Lactococcus lactis ... 60.8 4e-07 ref|ZP_08082642.1| cell division protein FtsX [Erysipelothrix rh... 60.8 4e-07 gb|ECR36241.1| hypothetical protein GOS_5486865 [marine metagenome] 60.5 4e-07 gb|ECV17731.1| hypothetical protein GOS_2949255 [marine metagenome] 60.5 4e-07 gb|EBE32281.1| hypothetical protein GOS_9783199 [marine metagenome] 60.5 4e-07 gb|EDB09477.1| hypothetical protein GOS_1883023 [marine metagenome] 60.5 4e-07 ref|YP_004058066.1| cell division protein ftsx [Oceanithermus pr... 60.5 4e-07 ref|YP_003651411.1| hypothetical protein Tbis_0794 [Thermobispor... 60.5 4e-07 gb|EDF63573.1| hypothetical protein GOS_920520 [marine metagenome] 60.5 4e-07 ref|ZP_07276901.1| conserved hypothetical protein [Streptomyces ... 60.5 4e-07 gb|ECW24183.1| hypothetical protein GOS_2755672 [marine metagenome] 60.5 4e-07 gb|ECV45210.1| hypothetical protein GOS_2896217 [marine metagenome] 60.5 4e-07 gb|EGG27600.1| cell division protein [Propionibacterium sp. P08] 60.5 4e-07 gb|EDG00140.1| hypothetical protein GOS_857432 [marine metagenome] 60.5 4e-07 gb|ECX76272.1| hypothetical protein GOS_2480525 [marine metagenome] 60.5 4e-07 gb|ECT74939.1| hypothetical protein GOS_4707780 [marine metagenome] 60.5 4e-07 gb|EBJ65487.1| hypothetical protein GOS_8862155 [marine metagenome] 60.5 4e-07 gb|ECX20128.1| hypothetical protein GOS_2581049 [marine metagenome] 60.5 5e-07 ref|ZP_06621868.1| efflux ABC transporter, permease protein [Tur... 60.1 5e-07 ref|YP_004454115.1| hypothetical protein Celf_2603 [Cellulomonas... 60.1 5e-07 gb|EDJ53582.1| hypothetical protein GOS_1678322 [marine metagenome] 60.1 5e-07 ref|ZP_06116079.1| putative cell division ABC transporter, perme... 60.1 5e-07 gb|ECW86873.1| hypothetical protein GOS_2641727 [marine metagenome] 60.1 5e-07 ref|YP_001032831.1| cell division protein ftsX-like protein [Lac... 60.1 5e-07 gb|EDJ64398.1| hypothetical protein GOS_1658878 [marine metagenome] 60.1 5e-07 gb|ECY58092.1| hypothetical protein GOS_2335396 [marine metagenome] 60.1 5e-07 gb|EDG20873.1| hypothetical protein GOS_821531 [marine metagenome] 60.1 6e-07 gb|EBI29154.1| hypothetical protein GOS_9117481 [marine metagenome] 60.1 6e-07 ref|YP_001516184.1| permease [Acaryochloris marina MBIC11017] >g... 60.1 6e-07 gb|ECE08151.1| hypothetical protein GOS_4356082 [marine metagenome] 60.1 6e-07 ref|ZP_08297013.1| efflux ABC transporter, permease protein [Bac... 60.1 6e-07 ref|ZP_08004731.1| cell-division protein [Bacillus sp. 2_A_57_CT... 60.1 6e-07 gb|ECT67045.1| hypothetical protein GOS_5036363 [marine metagenome] 60.1 6e-07 gb|EGD36144.1| cell division protein FtsX [Streptococcus sanguin... 60.1 6e-07 ref|ZP_08012196.1| hypothetical protein HMPREF9488_03032 [Coprob... 60.1 6e-07 gb|EDD88807.1| hypothetical protein GOS_1227403 [marine metagenome] 60.1 6e-07 gb|ECA61729.1| hypothetical protein GOS_4143878 [marine metagenome] 60.1 6e-07 gb|EBG13089.1| hypothetical protein GOS_9484823 [marine metagenome] 60.1 6e-07 gb|EFS75267.1| efflux ABC transporter, permease protein [Propion... 60.1 6e-07 ref|YP_003385648.1| hypothetical protein Slin_0786 [Spirosoma li... 60.1 6e-07 ref|ZP_07217986.1| cell division protein FtsX [Bacteroides sp. 2... 59.7 7e-07 gb|EBQ89877.1| hypothetical protein GOS_7681006 [marine metagenome] 59.7 7e-07 gb|ECF51634.1| hypothetical protein GOS_5943252 [marine metagenome] 59.7 7e-07 ref|ZP_07060261.1| putative cell division protein FtsX [Prevotel... 59.7 7e-07 ref|YP_003706486.1| hypothetical protein Trad_2844 [Truepera rad... 59.7 7e-07 ref|ZP_06088273.1| conserved hypothetical protein [Bacteroides s... 59.7 7e-07 ref|YP_001298482.1| putative cell division protein FtsX [Bactero... 59.7 7e-07 gb|EBF33498.1| hypothetical protein GOS_9614685 [marine metagenome] 59.7 7e-07 ref|YP_576016.1| hypothetical protein Nham_0668 [Nitrobacter ham... 59.7 8e-07 ref|YP_001943787.1| hypothetical protein Clim_1769 [Chlorobium l... 59.7 8e-07 ref|YP_002931249.1| cell division transport system permease [Eub... 59.7 8e-07 ref|ZP_04539658.1| cell division protein FtsX [Bacteroides sp. 9... 59.7 8e-07 gb|EBD84251.1| hypothetical protein GOS_9863379 [marine metagenome] 59.7 8e-07 ref|NP_627192.1| cell division protein [Streptomyces coelicolor ... 59.7 8e-07 gb|EDG22770.1| hypothetical protein GOS_818378 [marine metagenome] 59.7 8e-07 ref|YP_378843.1| cell division protein, putative [Chlorobium chl... 59.7 8e-07 gb|ECR86219.1| hypothetical protein GOS_3506661 [marine metagenome] 59.3 9e-07 ref|ZP_08146885.1| cell division protein FtsX [Enterococcus cass... 59.3 9e-07 gb|EBS51793.1| hypothetical protein GOS_7424604 [marine metagenome] 59.3 9e-07 ref|ZP_07937309.1| cell division transport system permease [Bact... 59.3 9e-07 ref|ZP_02039395.1| hypothetical protein RUMGNA_00148 [Ruminococc... 59.3 1e-06 gb|ECK15651.1| hypothetical protein GOS_4951990 [marine metagenome] 59.3 1e-06 ref|ZP_07364987.1| cell division protein FtsX [Prevotella marshi... 59.3 1e-06 gb|EBH40850.1| hypothetical protein GOS_9267651 [marine metagenome] 59.3 1e-06 ref|ZP_08468888.1| hypothetical protein HMPREF9456_00483 [Dysgon... 59.3 1e-06 ref|YP_001303756.1| cell division protein FtsX [Parabacteroides ... 59.3 1e-06 gb|EBP26617.1| hypothetical protein GOS_7938835 [marine metagenome] 59.3 1e-06 ref|YP_003681626.1| hypothetical protein Ndas_3722 [Nocardiopsis... 59.3 1e-06 gb|ECZ92120.1| hypothetical protein GOS_2096166 [marine metagenome] 59.3 1e-06 gb|ECE11368.1| hypothetical protein GOS_4240596 [marine metagenome] 58.9 1e-06 ref|ZP_05546492.1| cell division protein FtsX [Parabacteroides s... 58.9 1e-06 ref|YP_948371.1| cell division protein (FtsX) [Arthrobacter aure... 58.9 1e-06 ref|ZP_07748052.1| protein of unknown function DUF214 [Mucilagin... 58.9 1e-06 gb|ECL66837.1| hypothetical protein GOS_5975477 [marine metagenome] 58.9 1e-06 gb|ECZ75482.1| hypothetical protein GOS_2126759 [marine metagenome] 58.9 1e-06 gb|EBX89450.1| hypothetical protein GOS_6516323 [marine metagenome] 58.9 1e-06 gb|EBM21795.1| hypothetical protein GOS_8444555 [marine metagenome] 58.9 1e-06 ref|ZP_01966518.1| hypothetical protein RUMTOR_00056 [Ruminococc... 58.9 1e-06 ref|ZP_01886130.1| putative cell division protein [Pedobacter sp... 58.9 1e-06 ref|YP_003269856.1| hypothetical protein Hoch_5480 [Haliangium o... 58.5 1e-06 ref|ZP_06077040.1| cell division protein FtsX [Bacteroides sp. 2... 58.5 2e-06 ref|ZP_04671972.1| conserved hypothetical protein [Clostridiales... 58.5 2e-06 ref|ZP_05649900.1| cell division protein [Enterococcus gallinaru... 58.5 2e-06 ref|YP_001192921.1| hypothetical protein Fjoh_0567 [Flavobacteri... 58.5 2e-06 emb|CBK64116.1| Cell division protein [Alistipes shahii WAL 8301] 58.5 2e-06 gb|ECW95642.1| hypothetical protein GOS_2625269 [marine metagenome] 58.5 2e-06 ref|ZP_08612598.1| hypothetical protein HMPREF0991_01717 [Lachno... 58.5 2e-06 gb|EBG33541.1| hypothetical protein GOS_9450223 [marine metagenome] 58.5 2e-06 gb|EDF37857.1| hypothetical protein GOS_965617 [marine metagenome] 58.5 2e-06 ref|ZP_03495946.1| protein of unknown function DUF214 [Thermus a... 58.5 2e-06 gb|EDG70764.1| hypothetical protein GOS_735156 [marine metagenome] 58.5 2e-06 gb|EDI53230.1| hypothetical protein GOS_417070 [marine metagenome] 58.2 2e-06 gb|ECX12645.1| hypothetical protein GOS_2594348 [marine metagenome] 58.2 2e-06 gb|EGE90632.1| efflux ABC transporter, permease protein [Propion... 58.2 2e-06 ref|YP_004315799.1| hypothetical protein Sph21_0547 [Sphingobact... 58.2 2e-06 gb|EFS87482.1| efflux ABC transporter, permease protein [Propion... 58.2 2e-06 gb|EFS37843.1| efflux ABC transporter, permease protein [Propion... 58.2 2e-06 ref|YP_003575122.1| cell division protein FtsX [Prevotella rumin... 58.2 2e-06 ref|YP_003160830.1| cell division protein FtsX [Jonesia denitrif... 58.2 2e-06 gb|EDB05644.1| hypothetical protein GOS_1889473 [marine metagenome] 58.2 2e-06 ref|YP_004259324.1| hypothetical protein Bacsa_2302 [Bacteroides... 58.2 2e-06 gb|ECW40429.1| hypothetical protein GOS_2727262 [marine metagenome] 58.2 2e-06 gb|EDB86163.1| hypothetical protein GOS_1579441 [marine metagenome] 58.2 2e-06 ref|YP_004226017.1| cell division protein [Microbacterium testac... 58.2 2e-06 gb|EBK74763.1| hypothetical protein GOS_8681521 [marine metagenome] 57.8 3e-06 gb|ECS19541.1| hypothetical protein GOS_5672289 [marine metagenome] 57.8 3e-06 ref|YP_004524095.1| cell division protein FtsX [Mycobacterium sp... 57.8 3e-06 gb|ECO67725.1| hypothetical protein GOS_4480424 [marine metagenome] 57.8 3e-06 ref|ZP_04704447.1| cell division protein [Streptomyces albus J10... 57.8 3e-06 gb|ECY79585.1| hypothetical protein GOS_2295461 [marine metagenome] 57.8 3e-06 ref|ZP_07611159.1| protein of unknown function DUF214 [Streptomy... 57.8 3e-06 ref|YP_004445702.1| hypothetical protein Halhy_0928 [Haliscomeno... 57.8 3e-06 ref|ZP_05253743.1| cell division protein FtsX [Bacteroides sp. 4... 57.8 3e-06 ref|ZP_02181623.1| putative cell division protein [Flavobacteria... 57.8 3e-06 gb|ECF76149.1| hypothetical protein GOS_4952784 [marine metagenome] 57.8 3e-06 ref|YP_003554299.1| hypothetical protein Amico_1458 [Aminobacter... 57.8 3e-06 ref|ZP_02436089.1| hypothetical protein BACSTE_02345 [Bacteroide... 57.8 3e-06 ref|ZP_05036464.1| efflux ABC transporter, permease protein [Syn... 57.8 3e-06 gb|EDI48045.1| hypothetical protein GOS_425556 [marine metagenome] 57.4 4e-06 gb|EFT11188.1| efflux ABC transporter, permease protein [Propion... 57.4 4e-06 ref|YP_004601376.1| hypothetical protein Celgi_2308 [Cellvibrio ... 57.4 4e-06 gb|EDG85761.1| hypothetical protein GOS_709006 [marine metagenome] 57.4 4e-06 ref|ZP_08300999.1| efflux ABC transporter, permease protein [Bac... 57.4 4e-06 gb|EFS35456.1| efflux ABC transporter, permease protein [Propion... 57.4 4e-06 gb|ECO51986.1| hypothetical protein GOS_5109024 [marine metagenome] 57.4 4e-06 gb|EBH25976.1| hypothetical protein GOS_9293260 [marine metageno... 57.4 4e-06 ref|YP_001297216.1| cell division protein FtsX [Flavobacterium p... 57.4 4e-06 ref|ZP_02069111.1| hypothetical protein BACUNI_00516 [Bacteroide... 57.4 4e-06 gb|EDI83049.1| hypothetical protein GOS_1801433 [marine metagenome] 57.4 4e-06 gb|EBB62305.1| hypothetical protein GOS_202633 [marine metagenome] 57.4 4e-06 gb|ECC96272.1| hypothetical protein GOS_5319335 [marine metagenome] 57.4 4e-06 gb|ECY57843.1| hypothetical protein GOS_2335799 [marine metagenome] 57.4 4e-06 gb|EBW97383.1| hypothetical protein GOS_6661464 [marine metagenome] 57.4 4e-06 ref|ZP_05912646.1| putative cell division protein (FtsX) [Brevib... 57.4 4e-06 gb|EDB95202.1| hypothetical protein GOS_1563143 [marine metagenome] 57.0 4e-06 ref|ZP_01548769.1| hypothetical protein SIAM614_27028 [Stappia a... 57.0 4e-06 gb|EDG16420.1| hypothetical protein GOS_829338 [marine metagenome] 57.0 4e-06 gb|ECW67672.1| hypothetical protein GOS_2677384 [marine metagenome] 57.0 5e-06 ref|YP_004343766.1| hypothetical protein Fluta_0927 [Fluviicola ... 57.0 5e-06 ref|YP_320800.1| cell division protein FtsX [Anabaena variabilis... 57.0 5e-06 ref|ZP_03008987.1| hypothetical protein BACCOP_00839 [Bacteroide... 57.0 5e-06 gb|ECR81492.1| hypothetical protein GOS_3689127 [marine metagenome] 57.0 5e-06 gb|EDA03212.1| hypothetical protein GOS_2076150 [marine metagenome] 57.0 5e-06 ref|ZP_05989770.1| putative lipoprotein ABC superfamily ATP bind... 57.0 5e-06 gb|EDB28241.1| hypothetical protein GOS_1851058 [marine metagenome] 57.0 5e-06 ref|NP_923594.1| cell-division protein FtsX-like protein [Gloeob... 57.0 5e-06 gb|EDJ67765.1| hypothetical protein GOS_1652857 [marine metagenome] 57.0 5e-06 gb|EBO27050.1| hypothetical protein GOS_8108437 [marine metagenome] 57.0 5e-06 gb|EDI00003.1| hypothetical protein GOS_505466 [marine metagenome] 57.0 5e-06 ref|ZP_07838286.1| protein of unknown function DUF214 [Eubacteri... 57.0 5e-06 ref|ZP_03993050.1| cell division protein FtsX [Mobiluncus mulier... 57.0 5e-06 ref|ZP_04978412.1| possible lipoprotein ABC superfamily ATP bind... 57.0 5e-06 gb|ECF74276.1| hypothetical protein GOS_5021863 [marine metagenome] 57.0 5e-06 gb|EDB87115.1| hypothetical protein GOS_1577793 [marine metagenome] 56.6 6e-06 gb|ECV43878.1| hypothetical protein GOS_2898896 [marine metagenome] 56.6 6e-06 gb|EBU62290.1| hypothetical protein GOS_7031813 [marine metagenome] 56.6 6e-06 ref|ZP_07960170.1| cell-division protein [Lachnospiraceae bacter... 56.6 6e-06 ref|YP_004679.1| cell division protein ftsX [Thermus thermophilu... 56.6 6e-06 ref|YP_004254359.1| hypothetical protein Odosp_3220 [Odoribacter... 56.6 6e-06 gb|EBE06628.1| hypothetical protein GOS_9826745 [marine metagenome] 56.6 6e-06 gb|ECO51270.1| hypothetical protein GOS_5139980 [marine metagenome] 56.6 6e-06 gb|ECV97253.1| hypothetical protein GOS_2802881 [marine metagenome] 56.6 7e-06 gb|EBH54239.1| hypothetical protein GOS_9244896 [marine metagenome] 56.6 7e-06 gb|EBG75484.1| hypothetical protein GOS_9379688 [marine metagenome] 56.6 7e-06 gb|ECV46188.1| hypothetical protein GOS_2894302 [marine metagenome] 56.6 7e-06 emb|CCA56012.1| Cell division protein FtsX [Streptomyces venezue... 56.6 7e-06 gb|ECW15090.1| hypothetical protein GOS_2771815 [marine metagenome] 56.2 7e-06 gb|ECB80474.1| hypothetical protein GOS_6418822 [marine metagenome] 56.2 7e-06 ref|ZP_07832113.1| efflux ABC transporter, permease protein [Clo... 56.2 7e-06 ref|ZP_01452640.1| putative cell division protein [Mariprofundus... 56.2 7e-06 ref|YP_001135704.1| hypothetical protein Mflv_4447 [Mycobacteriu... 56.2 7e-06 ref|ZP_08584228.1| hypothetical protein HMPREF0127_01541 [Bacter... 56.2 8e-06 ref|ZP_03167966.1| hypothetical protein RUMLAC_01643 [Ruminococc... 56.2 8e-06 gb|EBI18903.1| hypothetical protein GOS_9134643 [marine metagenome] 56.2 8e-06 ref|NP_485797.1| cell-division protein [Nostoc sp. PCC 7120] >db... 56.2 8e-06 ref|YP_001414937.1| hypothetical protein Xaut_0021 [Xanthobacter... 56.2 8e-06 ref|ZP_01131019.1| cell division protein [marine actinobacterium... 56.2 8e-06 gb|ECW36146.1| hypothetical protein GOS_2734778 [marine metagenome] 56.2 8e-06 gb|ECB48607.1| hypothetical protein GOS_4179167 [marine metagenome] 56.2 8e-06 gb|ECB04618.1| hypothetical protein GOS_5924252 [marine metagenome] 56.2 8e-06 ref|YP_001208297.1| cell division ABC transporter membrane compo... 56.2 8e-06 ref|ZP_07955359.1| hypothetical protein HMPREF0996_00338 [Lachno... 56.2 8e-06 gb|EBI57760.1| hypothetical protein GOS_9069179 [marine metagenome] 56.2 9e-06 ref|ZP_07038241.1| cell division protein FtsX [Bacteroides sp. 3... 56.2 9e-06 ref|ZP_08025277.1| cell division protein FtsX [Dietzia cinnamea ... 56.2 9e-06 gb|EGF37528.1| cell division protein FtsX [Lactobacillus rhamnos... 55.8 1e-05 gb|ECX54526.1| hypothetical protein GOS_2519033 [marine metagenome] 55.8 1e-05 gb|ECQ12096.1| hypothetical protein GOS_3405178 [marine metagenome] 55.8 1e-05 gb|ECY02756.1| hypothetical protein GOS_2430930 [marine metagenome] 55.8 1e-05 ref|YP_001237330.1| cell division ABC transporter membrane compo... 55.8 1e-05 gb|EBE53783.1| hypothetical protein GOS_9747039 [marine metagenome] 55.8 1e-05 gb|ECF04711.1| hypothetical protein GOS_4270680 [marine metagenome] 55.8 1e-05 ref|YP_003687923.1| Cell division protein [Propionibacterium fre... 55.8 1e-05 ref|YP_568083.1| hypothetical protein RPD_0944 [Rhodopseudomonas... 55.8 1e-05 gb|EBP34173.1| hypothetical protein GOS_7926859 [marine metagenome] 55.8 1e-05 ref|ZP_03641860.1| hypothetical protein BACCOPRO_00196 [Bacteroi... 55.5 1e-05 ref|YP_003491143.1| cell division protein [Streptomyces scabiei ... 55.5 1e-05 ref|YP_004160355.1| cell division protein FtsX [Bacteroides helc... 55.5 1e-05 gb|ECG61531.1| hypothetical protein GOS_5034920 [marine metagenome] 55.5 1e-05 gb|EBF74798.1| hypothetical protein GOS_9547040 [marine metagenome] 55.5 1e-05 gb|EBH50270.1| hypothetical protein GOS_9251707 [marine metagenome] 55.5 1e-05 gb|EBI40907.1| hypothetical protein GOS_9097613 [marine metagenome] 55.5 1e-05 ref|YP_003194668.1| putative cell division protein [Robiginitale... 55.5 1e-05 ref|ZP_01959793.1| hypothetical protein BACCAC_01402 [Bacteroide... 55.5 2e-05 ref|YP_873488.1| cell division protein FtsX [Acidothermus cellul... 55.5 2e-05 ref|ZP_04552594.1| cell division protein FtsX [Bacteroides sp. 2... 55.1 2e-05 ref|ZP_07025402.1| cell division protein [Afipia sp. 1NLS2] >gb|... 55.1 2e-05 ref|YP_001377908.1| hypothetical protein Anae109_0711 [Anaeromyx... 55.1 2e-05 gb|ECG38732.1| hypothetical protein GOS_5980066 [marine metagenome] 55.1 2e-05 ref|YP_783730.1| hypothetical protein RPE_4831 [Rhodopseudomonas... 55.1 2e-05 ref|YP_003120954.1| hypothetical protein Cpin_1255 [Chitinophaga... 55.1 2e-05 gb|ECL76191.1| hypothetical protein GOS_5596952 [marine metagenome] 55.1 2e-05 ref|YP_001318404.1| hypothetical protein Amet_0518 [Alkaliphilus... 55.1 2e-05 ref|YP_004541687.1| protein of unknown function DUF214 [Isopteri... 55.1 2e-05 ref|YP_004119913.1| hypothetical protein Daes_0140 [Desulfovibri... 55.1 2e-05 ref|ZP_07312710.1| cell division protein [Streptomyces griseofla... 54.7 2e-05 ref|ZP_08593358.1| hypothetical protein HMPREF1017_00466 [Bacter... 54.7 2e-05 ref|YP_003173642.1| cell division protein FtsX [Lactobacillus rh... 54.7 2e-05 ref|YP_002249280.1| efflux ABC transporter, permease protein [Th... 54.7 2e-05 gb|EBQ30793.1| hypothetical protein GOS_7770896 [marine metagenome] 54.7 2e-05 ref|YP_001363507.1| hypothetical protein Krad_3780 [Kineococcus ... 54.7 2e-05 gb|ECK41667.1| hypothetical protein GOS_3943369 [marine metagenome] 54.7 2e-05 gb|EBP87192.1| hypothetical protein GOS_7840563 [marine metagenome] 54.7 2e-05 ref|YP_003159604.1| hypothetical protein Dbac_3113 [Desulfomicro... 54.7 2e-05 ref|YP_484457.1| hypothetical protein RPB_0835 [Rhodopseudomonas... 54.7 3e-05 ref|ZP_05759132.1| cell division protein FtsX [Bacteroides sp. D... 54.7 3e-05 gb|EBV76550.1| hypothetical protein GOS_6854142 [marine metagenome] 54.7 3e-05 ref|ZP_04687892.1| cell division protein [Streptomyces ghanaensi... 54.7 3e-05 ref|ZP_05417015.1| putative cell division protein FtsX [Bacteroi... 54.7 3e-05 ref|YP_002247291.1| efflux ABC transporter permease [Coprothermo... 54.7 3e-05 gb|ECO57957.1| hypothetical protein GOS_4870212 [marine metagenome] 54.3 3e-05 ref|ZP_04547393.1| cell division protein FtsX [Bacteroides sp. D... 54.3 3e-05 ref|YP_003098751.1| cell division protein FtsX [Actinosynnema mi... 54.3 3e-05 ref|ZP_02065924.1| hypothetical protein BACOVA_02911 [Bacteroide... 54.3 3e-05 gb|EBQ03985.1| hypothetical protein GOS_7812745 [marine metagenome] 54.3 3e-05 ref|ZP_03969767.1| cell division protein [Sphingobacterium spiri... 54.3 3e-05 gb|EDB80305.1| hypothetical protein GOS_1590005 [marine metagenome] 54.3 3e-05 gb|EDB21700.1| hypothetical protein GOS_1862591 [marine metagenome] 54.3 3e-05 gb|EDJ68602.1| hypothetical protein GOS_1651328 [marine metagenome] 54.3 3e-05 gb|EDE76647.1| hypothetical protein GOS_1073664 [marine metagenome] 54.3 3e-05 ref|ZP_07336668.1| outer membrane-specific lipoprotein transport... 54.3 3e-05 ref|YP_001653076.1| outer membrane-specific lipoprotein transpor... 54.3 4e-05 gb|EDC26393.1| hypothetical protein GOS_1507119 [marine metagenome] 54.3 4e-05 ref|ZP_00348325.1| COG4591: ABC-type transport system, involved ... 53.9 4e-05 ref|ZP_07535600.1| Lipoprotein-releasing system transmembrane pr... 53.9 4e-05 ref|YP_001969917.1| lipoprotein-releasing system transmembrane p... 53.9 4e-05 gb|ECP67228.1| hypothetical protein GOS_5148064 [marine metagenome] 53.9 4e-05 ref|ZP_07672639.1| cell division ABC transporter, permease prote... 53.9 4e-05 ref|ZP_07531186.1| Lipoprotein-releasing system transmembrane pr... 53.9 4e-05 ref|YP_317196.1| hypothetical protein Nwi_0577 [Nitrobacter wino... 53.9 4e-05 gb|EBU82363.1| hypothetical protein GOS_7000228 [marine metagenome] 53.9 4e-05 ref|ZP_07542136.1| Lipoprotein-releasing system transmembrane pr... 53.9 4e-05 gb|EBY37124.1| hypothetical protein GOS_6127241 [marine metagenome] 53.9 4e-05 ref|ZP_07526891.1| Lipoprotein-releasing system transmembrane pr... 53.9 4e-05 ref|ZP_07304133.1| cell division protein [Streptomyces viridochr... 53.9 4e-05 ref|ZP_07287099.1| cell division protein [Streptomyces sp. C] >g... 53.9 4e-05 ref|ZP_03206657.1| hypothetical protein BACPLE_00262 [Bacteroide... 53.9 4e-05 gb|EDB66491.1| hypothetical protein GOS_1615744 [marine metagenome] 53.9 4e-05 gb|EFU11295.1| efflux ABC transporter, permease protein [Enteroc... 53.9 5e-05 ref|ZP_07907990.1| cell division protein [Mobiluncus curtisii AT... 53.5 5e-05 ref|ZP_01629261.1| cell-division protein [Nodularia spumigena CC... 53.5 5e-05 ref|YP_012583.1| permease [Desulfovibrio vulgaris str. Hildenbor... 53.5 5e-05 gb|ECB29354.1| hypothetical protein GOS_4945503 [marine metagenome] 53.5 5e-05 gb|EBD11952.1| hypothetical protein GOS_9981195 [marine metagenome] 53.5 5e-05 gb|EBF31980.1| hypothetical protein GOS_9617204 [marine metagenome] 53.5 5e-05 ref|ZP_07818370.1| efflux ABC transporter, permease protein [Ere... 53.5 5e-05 ref|ZP_06093064.1| cell division protein FtsX [Bacteroides sp. 2... 53.5 5e-05 gb|ADP85186.1| protein of unknown function DUF214 [Desulfovibrio... 53.5 5e-05 ref|YP_003337191.1| cell division protein-like protein [Streptos... 53.5 5e-05 ref|YP_003506245.1| cell division protein FtsX [Meiothermus rube... 53.5 5e-05 ref|YP_097337.1| cell division protein FtsX [Bacteroides fragili... 53.5 5e-05 gb|EBZ52618.1| hypothetical protein GOS_4985576 [marine metagenome] 53.5 5e-05 ref|NP_737423.1| hypothetical protein CE0813 [Corynebacterium ef... 53.5 5e-05 gb|ECR95428.1| hypothetical protein GOS_3140031 [marine metagenome] 53.5 5e-05 ref|NP_826282.1| cell division protein [Streptomyces avermitilis... 53.5 6e-05 ref|ZP_04389837.1| cell division protein FtsX [Porphyromonas end... 53.5 6e-05 gb|ECT67176.1| hypothetical protein GOS_5030942 [marine metagenome] 53.5 6e-05 gb|ECR20349.1| hypothetical protein GOS_6119300 [marine metagenome] 53.5 6e-05 gb|EFR99097.1| putative cell division protein [Listeria seeliger... 53.1 6e-05 ref|YP_003719193.1| cell division protein [Mobiluncus curtisii A... 53.1 6e-05 ref|YP_002287772.1| cell division protein [Oligotropha carboxido... 53.1 6e-05 ref|ZP_05558684.1| cell division ABC transporter, permease FtsX ... 53.1 6e-05 ref|ZP_07909943.1| cell division protein [Mobiluncus curtisii su... 53.1 6e-05 gb|EFU18835.1| efflux ABC transporter, permease protein [Enteroc... 53.1 6e-05 ref|YP_003315256.1| cell division protein FtsX [Sanguibacter ked... 53.1 6e-05 ref|ZP_05423132.1| predicted protein [Enterococcus faecalis T1] ... 53.1 7e-05 ref|ZP_05599363.1| cell division ABC transporter permease [Enter... 53.1 7e-05 ref|ZP_04438543.1| cell divison ABC superfamily ATP binding cass... 53.1 7e-05 ref|YP_002993359.1| hypothetical protein Desal_3775 [Desulfovibr... 53.1 7e-05 ref|NP_815463.1| cell division ABC transporter permease FtsX, [E... 53.1 7e-05 ref|YP_001692492.1| cell division protein [Finegoldia magna ATCC... 53.1 7e-05 gb|EBC29755.1| hypothetical protein GOS_92917 [marine metagenome] 53.1 7e-05 ref|YP_002491123.1| protein of unknown function DUF214 [Anaeromy... 53.1 7e-05 ref|YP_003112172.1| cell division protein FtsX [Catenulispora ac... 53.1 7e-05 gb|EBB26916.1| hypothetical protein GOS_261875 [marine metagenome] 53.1 8e-05 ref|ZP_07297280.1| cell division protein FtsX [Streptomyces hygr... 53.1 8e-05 ref|YP_003721714.1| hypothetical protein Aazo_2723 ['Nostoc azol... 52.8 8e-05 ref|ZP_06837423.1| cell division protein FtsX [Corynebacterium a... 52.8 8e-05 ref|ZP_05565909.1| cell division protein FtsX [Enterococcus faec... 52.8 8e-05 ref|YP_002133069.1| hypothetical protein AnaeK_0701 [Anaeromyxob... 52.8 8e-05 gb|EDD80379.1| hypothetical protein GOS_1241843 [marine metagenome] 52.8 8e-05 ref|ZP_07268012.1| efflux ABC transporter, permease protein [Fin... 52.8 8e-05 ref|YP_003132662.1| cell division protein FtsX [Saccharomonospor... 52.8 8e-05 ref|ZP_05581406.1| cell division protein FtsX [Enterococcus faec... 52.8 8e-05 gb|ECX27866.1| hypothetical protein GOS_2567353 [marine metagenome] 52.8 9e-05 gb|EBF85071.1| hypothetical protein GOS_9530396 [marine metagenome] 52.8 9e-05 ref|ZP_01965338.1| hypothetical protein RUMOBE_03077 [Ruminococc... 52.8 9e-05 ref|YP_001769089.1| hypothetical protein M446_2194 [Methylobacte... 52.8 9e-05 ref|ZP_05503326.1| cell division protein FtsX [Enterococcus faec... 52.8 9e-05 ref|ZP_07320790.1| efflux ABC transporter, permease protein [Fin... 52.8 1e-04 emb|CBK73212.1| Cell division protein [Butyrivibrio fibrisolvens... 52.8 1e-04 ref|ZP_03460490.1| hypothetical protein BACEGG_03307 [Bacteroide... 52.4 1e-04 ref|YP_965474.1| hypothetical protein Dvul_0023 [Desulfovibrio v... 52.4 1e-04 gb|ECQ04132.1| hypothetical protein GOS_3707308 [marine metagenome] 52.4 1e-04 ref|ZP_05860799.1| putative cell-division protein FtsX-like prot... 52.4 1e-04 gb|ECG71049.1| hypothetical protein GOS_4659749 [marine metagenome] 52.4 1e-04 gb|EBC52418.1| hypothetical protein GOS_56296 [marine metagenome] 52.4 1e-04 ref|YP_004421135.1| outer membrane-specific lipoprotein transpor... 52.4 1e-04 ref|YP_004112597.1| hypothetical protein Selin_1306 [Desulfurisp... 52.4 1e-04 ref|YP_002785714.1| cell division protein FtsX [Deinococcus dese... 52.4 1e-04 ref|YP_003697543.1| hypothetical protein Arch_1219 [Arcanobacter... 52.4 1e-04 ref|YP_088377.1| outer membrane-specific lipoprotein transporter... 52.4 1e-04 ref|ZP_06823833.1| cell division protein [Streptomyces sp. SPB74... 52.4 1e-04 dbj|BAJ28698.1| putative cell division protein FtsX [Kitasatospo... 52.4 1e-04 ref|ZP_05858800.1| putative membrane protein [Prevotella veroral... 52.4 1e-04 ref|ZP_03393713.1| cell division protein FtsX [Corynebacterium a... 52.0 1e-04 ref|ZP_02963878.1| FtsX-like protein involved in cell division [... 52.0 1e-04 gb|EDE84189.1| hypothetical protein GOS_1060431 [marine metagenome] 52.0 1e-04 gb|EDF42860.1| hypothetical protein GOS_956794 [marine metagenome] 52.0 1e-04 gb|EDH01556.1| hypothetical protein GOS_681151 [marine metagenome] 52.0 1e-04 gb|EBO23998.1| hypothetical protein GOS_8113302 [marine metagenome] 52.0 1e-04 gb|ECU12421.1| hypothetical protein GOS_3255259 [marine metagenome] 52.0 2e-04 gb|ECZ93847.1| hypothetical protein GOS_2092909 [marine metagenome] 52.0 2e-04 gb|ECX57825.1| hypothetical protein GOS_2513120 [marine metagenome] 52.0 2e-04 gb|ECO90488.1| hypothetical protein GOS_3615345 [marine metagenome] 52.0 2e-04 gb|EBB88094.1| hypothetical protein GOS_160521 [marine metagenome] 52.0 2e-04 ref|ZP_08111616.1| protein of unknown function DUF214 [Desulfovi... 52.0 2e-04 gb|ADW05344.1| protein of unknown function DUF214 [Streptomyces ... 52.0 2e-04 ref|YP_001710772.1| putative cell division protein [Clavibacter ... 52.0 2e-04 ref|YP_250232.1| cell division protein FtsX [Corynebacterium jei... 52.0 2e-04 gb|EBY03158.1| hypothetical protein GOS_5846656 [marine metagenome] 51.6 2e-04 gb|ECH10281.1| hypothetical protein GOS_3126784 [marine metagenome] 51.6 2e-04 ref|YP_886450.1| cell division protein FtsX [Mycobacterium smegm... 51.6 2e-04 ref|ZP_06911471.1| cell division protein [Streptomyces pristinae... 51.6 2e-04 ref|NP_812122.1| cell division protein FtsX [Bacteroides thetaio... 51.6 2e-04 ref|ZP_06945911.1| cell division protein [Finegoldia magna ATCC ... 51.6 2e-04 ref|ZP_08148315.1| lipoprotein ABC superfamily ATP binding casse... 51.6 2e-04 gb|EBO28223.1| hypothetical protein GOS_8106428 [marine metagenome] 51.6 2e-04 gb|ECV90408.1| hypothetical protein GOS_2814713 [marine metagenome] 51.2 2e-04 ref|YP_004042377.1| hypothetical protein Palpr_1245 [Paludibacte... 51.2 2e-04 ref|ZP_06889051.1| conserved hypothetical protein [Methylosinus ... 51.2 2e-04 ref|ZP_05001917.1| cell division protein [Streptomyces sp. Mg1] ... 51.2 2e-04 gb|EBN18607.1| hypothetical protein GOS_8287909 [marine metagenome] 51.2 2e-04 gb|EDJ52522.1| hypothetical protein GOS_1680179 [marine metagenome] 51.2 3e-04 ref|YP_001222051.1| putative ABC transporter permease,involved i... 51.2 3e-04 emb|CBW15553.1| outer membrane-specific lipoprotein transporter ... 51.2 3e-04 ref|YP_001994180.1| hypothetical protein Rpal_5217 [Rhodopseudom... 51.2 3e-04 ref|ZP_02043270.1| hypothetical protein ACTODO_00109 [Actinomyce... 51.2 3e-04 gb|ECB69956.1| hypothetical protein GOS_3344056 [marine metagenome] 51.2 3e-04 gb|ADI09650.1| cell division protein [Streptomyces bingchenggens... 50.8 3e-04 gb|ECU03375.1| hypothetical protein GOS_3605369 [marine metagenome] 50.8 3e-04 gb|EBC28218.1| hypothetical protein GOS_95330 [marine metagenome] 50.8 3e-04 ref|ZP_08071565.1| protein of unknown function DUF214 [Methylocy... 50.8 3e-04 gb|EDE67680.1| hypothetical protein GOS_1089377 [marine metagenome] 50.8 3e-04 ref|YP_002765758.1| cell division protein FtsX [Rhodococcus eryt... 50.8 3e-04 emb|CAM75792.1| Cell division protein [Magnetospirillum gryphisw... 50.8 3e-04 ref|YP_463880.1| cell division protein FtsX [Anaeromyxobacter de... 50.8 3e-04 ref|ZP_07337984.1| outer membrane-specific lipoprotein transport... 50.8 4e-04 ref|ZP_05735651.2| cell division protein FtsX [Prevotella tanner... 50.8 4e-04 gb|ECM70922.1| hypothetical protein GOS_5331537 [marine metagenome] 50.8 4e-04 ref|ZP_06114845.1| putative cell division protein [Clostridium h... 50.4 4e-04 gb|EDC74599.1| hypothetical protein GOS_1421798 [marine metagenome] 50.4 4e-04 gb|ECB53600.1| hypothetical protein GOS_3988367 [marine metagenome] 50.4 4e-04 ref|ZP_08475735.1| hypothetical protein HMPREF9455_03901 [Dysgon... 50.4 5e-04 ref|YP_004629265.1| Cell division protein [Corynebacterium ulcer... 50.4 5e-04 ref|YP_001310319.1| hypothetical protein Cbei_3234 [Clostridium ... 50.4 5e-04 ref|YP_003636344.1| protein of unknown function DUF214 [Cellulom... 50.1 5e-04 ref|YP_004494962.1| cell division protein FtsX [Amycolicicoccus ... 50.1 6e-04 ref|ZP_04693590.1| putative cell division protein [Streptomyces ... 50.1 6e-04 ref|YP_003317006.1| hypothetical protein Taci_0488 [Thermanaerov... 50.1 6e-04 ref|ZP_03700627.1| protein of unknown function DUF214 [Flavobact... 50.1 6e-04 gb|EBO47316.1| hypothetical protein GOS_8074484 [marine metagenome] 50.1 6e-04 ref|YP_004331286.1| hypothetical protein Psed_1187 [Pseudonocard... 50.1 6e-04 gb|ECR74014.1| hypothetical protein GOS_3985407 [marine metagenome] 50.1 6e-04 ref|ZP_08323910.1| lipoprotein releasing system, transmembrane p... 50.1 6e-04 ref|ZP_06917467.1| cell division protein [Streptomyces sviceus A... 50.1 6e-04 gb|EBE12117.1| hypothetical protein GOS_9817265 [marine metagenome] 49.7 7e-04 ref|YP_374358.1| cell division protein [Chlorobium luteolum DSM ... 49.7 7e-04 gb|EDD73142.1| hypothetical protein GOS_1254364 [marine metageno... 49.7 7e-04 gb|ECQ11188.1| hypothetical protein GOS_3438480 [marine metagenome] 49.7 7e-04 gb|EBP00950.1| hypothetical protein GOS_7982767 [marine metagenome] 49.7 7e-04 ref|ZP_05847582.1| cell division protein FtsX [Corynebacterium j... 49.7 7e-04 ref|ZP_07343522.1| lipoprotein releasing system, transmembrane p... 49.7 8e-04 gb|ECZ46275.1| hypothetical protein GOS_2179552 [marine metagenome] 49.7 8e-04 gb|EBO03934.1| hypothetical protein GOS_8147281 [marine metagenome] 49.7 8e-04 gb|EBY92051.1| hypothetical protein GOS_3918323 [marine metagenome] 49.7 9e-04 ref|ZP_06417379.1| protein of unknown function DUF214 [Frankia s... 49.7 9e-04 gb|EBD77108.1| hypothetical protein GOS_9874927 [marine metagenome] 49.3 9e-04 gb|ECG67188.1| hypothetical protein GOS_4816253 [marine metagenome] 49.3 0.001 gb|ECK19902.1| hypothetical protein GOS_4789728 [marine metagenome] 49.3 0.001 gb|EBM31698.1| hypothetical protein GOS_8429205 [marine metagenome] 49.3 0.001 ref|YP_004111185.1| hypothetical protein Rpdx1_4911 [Rhodopseudo... 49.3 0.001 gb|EDB56739.1| hypothetical protein GOS_1633856 [marine metagenome] 49.3 0.001 gb|EBB84313.1| hypothetical protein GOS_166780 [marine metagenome] 49.3 0.001 ref|NP_768031.1| cell division protein [Bradyrhizobium japonicum... 49.3 0.001 ref|ZP_01733977.1| putative cell division protein [Flavobacteria... 49.3 0.001 ref|ZP_01796442.1| cell division protein FtsX [Haemophilus influ... 49.3 0.001 ref|YP_001611725.1| ABC transporter permease [Sorangium cellulos... 49.3 0.001 ref|YP_004051045.1| hypothetical protein Calni_0971 [Calditerriv... 49.3 0.001 gb|ECN00533.1| hypothetical protein GOS_4151087 [marine metagenome] 49.3 0.001 gb|EDE51030.1| hypothetical protein GOS_1118436 [marine metagenome] 49.3 0.001 gb|ECO66633.1| hypothetical protein GOS_4523221 [marine metagenome] 49.3 0.001 gb|EBU72604.1| hypothetical protein GOS_7015679 [marine metagenome] 48.9 0.001 gb|EBG35368.1| hypothetical protein GOS_9447098 [marine metagenome] 48.9 0.001 ref|YP_638779.1| cell division protein FtsX [Mycobacterium sp. M... 48.9 0.001 gb|EBP60803.1| hypothetical protein GOS_7884005 [marine metagenome] 48.9 0.001 gb|EDE44484.1| hypothetical protein GOS_1129473 [marine metagenome] 48.9 0.001 gb|EBS44744.1| hypothetical protein GOS_7435787 [marine metagenome] 48.5 0.002 gb|EBA71907.1| hypothetical protein GOS_354188 [marine metagenome] 48.5 0.002 ref|YP_004301864.1| Efflux ABC transporter permease [polymorphum... 48.5 0.002 ref|YP_001826071.1| putative cell division protein [Streptomyces... 48.5 0.002 ref|ZP_03925245.1| cell division protein FtsX [Actinomyces coleo... 48.5 0.002 gb|EDH37133.1| hypothetical protein GOS_617917 [marine metagenome] 48.5 0.002 gb|EBI52261.1| hypothetical protein GOS_9078480 [marine metagenome] 48.5 0.002 gb|EDI97210.1| hypothetical protein GOS_1776901 [marine metagenome] 48.5 0.002 gb|ECG24998.1| hypothetical protein GOS_3037537 [marine metagenome] 48.5 0.002 ref|ZP_07889679.1| lipoprotein ABC superfamily ATP binding casse... 48.5 0.002 ref|ZP_02520109.1| cell division protein FtsX [candidate divisio... 48.1 0.002 ref|ZP_08066607.1| lipoprotein-releasing ABC superfamily ATP bin... 48.1 0.002 ref|ZP_08449171.1| efflux ABC transporter, permease protein [Cap... 48.1 0.002 gb|ECH72771.1| hypothetical protein GOS_4108508 [marine metagenome] 48.1 0.002 gb|EDJ60316.1| hypothetical protein GOS_1666424 [marine metagenome] 48.1 0.002 gb|EDI21455.1| hypothetical protein GOS_469409 [marine metagenome] 48.1 0.002 gb|EBM19282.1| hypothetical protein GOS_8448534 [marine metagenome] 48.1 0.002 gb|ECG63936.1| hypothetical protein GOS_4945868 [marine metageno... 48.1 0.003 gb|EBO68233.1| hypothetical protein GOS_8038788 [marine metagenome] 47.8 0.003 gb|EBL87626.1| hypothetical protein GOS_8499833 [marine metagenome] 47.8 0.003 ref|ZP_07704549.1| efflux ABC transporter, permease protein [Der... 47.8 0.003 gb|EBO92229.1| hypothetical protein GOS_7997540 [marine metagenome] 47.8 0.003 gb|EDB44887.1| hypothetical protein GOS_1822415 [marine metagenome] 47.8 0.003 gb|ECX87959.1| hypothetical protein GOS_2459372 [marine metagenome] 47.8 0.003 gb|ECH25714.1| hypothetical protein GOS_5992057 [marine metagenome] 47.8 0.003 ref|YP_847173.1| hypothetical protein Sfum_3065 [Syntrophobacter... 47.8 0.003 gb|ECH10979.1| hypothetical protein GOS_3101313 [marine metagenome] 47.8 0.003 gb|ECR48604.1| hypothetical protein GOS_4981019 [marine metagenome] 47.8 0.003 gb|EDH43071.1| hypothetical protein GOS_607154 [marine metagenome] 47.8 0.003 gb|EDE44755.1| hypothetical protein GOS_1129034 [marine metagenome] 47.8 0.003 gb|EBO54408.1| hypothetical protein GOS_8062439 [marine metagenome] 47.8 0.003 ref|ZP_06274243.1| protein of unknown function DUF214 [Streptomy... 47.8 0.003 ref|YP_001867367.1| hypothetical protein Npun_R4045 [Nostoc punc... 47.4 0.003 ref|YP_001624509.1| cell division protein [Renibacterium salmoni... 47.4 0.003 gb|EBL66616.1| hypothetical protein GOS_8534262 [marine metagenome] 47.4 0.003 ref|YP_604945.1| hypothetical protein Dgeo_1481 [Deinococcus geo... 47.4 0.004 gb|EBP01198.1| hypothetical protein GOS_7982389 [marine metagenome] 47.4 0.004 gb|EBJ57160.1| hypothetical protein GOS_8876174 [marine metagenome] 47.4 0.004 gb|EDD48075.1| hypothetical protein GOS_1297346 [marine metagenome] 47.4 0.004 ref|YP_003583214.1| ABC transporter efflux protein [Zunongwangia... 47.4 0.004 gb|ECN96816.1| hypothetical protein GOS_3844508 [marine metagenome] 47.4 0.004 ref|YP_003093797.1| hypothetical protein Phep_3544 [Pedobacter h... 47.4 0.004 gb|EBU40452.1| hypothetical protein GOS_7119775 [marine metagenome] 47.4 0.004 ref|YP_534707.1| hypothetical protein RPC_4866 [Rhodopseudomonas... 47.4 0.004 ref|ZP_07376115.1| cell division protein [Ahrensia sp. R2A130] >... 47.0 0.004 ref|ZP_03935613.1| cell division protein [Corynebacterium striat... 47.0 0.004 ref|YP_004554520.1| hypothetical protein Sphch_2353 [Sphingobium... 47.0 0.005 gb|EBJ36892.1| hypothetical protein GOS_8909890 [marine metagenome] 47.0 0.005 ref|ZP_05116425.1| efflux ABC transporter, permease protein [Lab... 47.0 0.005 ref|ZP_06595605.1| putative cell division protein [Bifidobacteri... 47.0 0.005 gb|ECR72113.1| hypothetical protein GOS_4058912 [marine metagenome] 47.0 0.005 gb|ECY00856.1| hypothetical protein GOS_2434588 [marine metagenome] 47.0 0.005 ref|YP_001137784.1| hypothetical protein cgR_0908 [Corynebacteri... 47.0 0.005 ref|ZP_02086969.1| hypothetical protein CLOBOL_04513 [Clostridiu... 47.0 0.006 ref|NP_600032.1| cell division protein [Corynebacterium glutamic... 47.0 0.006 gb|ECE49797.1| hypothetical protein GOS_6455289 [marine metagenome] 46.6 0.006 ref|ZP_03612029.1| outer membrane-specific lipoprotein transport... 46.6 0.006 ref|ZP_08197151.1| cell division protein [Nocardioidaceae bacter... 46.6 0.006 ref|ZP_08321058.1| efflux ABC transporter, permease protein [Par... 46.6 0.006 gb|ECO11850.1| hypothetical protein GOS_3259230 [marine metagenome] 46.6 0.006 ref|ZP_03392162.1| FtsX family membrane protein [Capnocytophaga ... 46.6 0.006 ref|YP_003155429.1| cell division protein [Brachybacterium faeci... 46.6 0.007 ref|ZP_07834766.1| efflux ABC transporter, permease protein [Clo... 46.6 0.007 ref|YP_003763469.1| cell division transport system permease prot... 46.6 0.007 ref|ZP_04754609.1| outer membrane-specific lipoprotein transport... 46.6 0.007 ref|ZP_08149344.1| hypothetical protein HMPREF0490_00076 [Lachno... 46.6 0.007 gb|EBO99483.1| hypothetical protein GOS_7985229 [marine metagenome] 46.6 0.007 gb|ECI45618.1| hypothetical protein GOS_4716772 [marine metagenome] 46.6 0.007 gb|EDH46677.1| hypothetical protein GOS_600654 [marine metagenome] 46.6 0.007 ref|ZP_03709960.1| hypothetical protein CORMATOL_00775 [Coryneba... 46.6 0.007 ref|ZP_01044569.1| hypothetical protein NB311A_03544 [Nitrobacte... 46.6 0.007 gb|ECO50219.1| hypothetical protein GOS_5180572 [marine metagenome] 46.2 0.008 ref|YP_004573705.1| cell division protein FtsX [Microlunatus pho... 46.2 0.008 ref|ZP_08334643.1| hypothetical protein HMPREF0987_00946 [Lachno... 46.2 0.008 ref|ZP_08446277.1| efflux ABC transporter, permease protein [Cap... 46.2 0.008 ref|ZP_06973723.1| protein of unknown function DUF214 [Ktedonoba... 46.2 0.008 gb|EBC43148.1| hypothetical protein GOS_70989 [marine metagenome] 46.2 0.009 ref|ZP_08135150.1| hypothetical protein HMPREF9141_0359 [Prevote... 46.2 0.009 ref|YP_922470.1| cell division protein FtsX [Nocardioides sp. JS... 46.2 0.009 ref|YP_479912.1| cell division protein FtsX [Frankia sp. CcI3] >... 46.2 0.009 ref|YP_120699.1| putative cell division membrane protein [Nocard... 46.2 0.009 ref|ZP_07402920.1| efflux ABC transporter, permease protein [Cor... 46.2 0.009 ref|YP_003141661.1| hypothetical protein Coch_1555 [Capnocytopha... 46.2 0.010 ref|YP_001344723.1| outer membrane-specific lipoprotein transpor... 45.8 0.010 gb|EDA72901.1| hypothetical protein GOS_1948155 [marine metagenome] 45.8 0.011 gb|EBO36566.1| hypothetical protein GOS_8092559 [marine metagenome] 45.8 0.011 gb|ECA38321.1| hypothetical protein GOS_5074892 [marine metagenome] 45.8 0.011 gb|ECA89731.1| hypothetical protein GOS_3047272 [marine metagenome] 45.8 0.011 gb|EDE45201.1| hypothetical protein GOS_1128284 [marine metagenome] 45.8 0.012 ref|YP_003274539.1| hypothetical protein Gbro_3452 [Gordonia bro... 45.8 0.012 gb|EBO32736.1| hypothetical protein GOS_8098946 [marine metagenome] 45.8 0.012 gb|EDH39048.1| hypothetical protein GOS_614442 [marine metagenome] 45.8 0.013 gb|ECI23851.1| hypothetical protein GOS_5595235 [marine metagenome] 45.4 0.013 ref|ZP_07865309.1| ABC superfamily ATP binding cassette transpor... 45.4 0.013 gb|ECR72872.1| hypothetical protein GOS_4027133 [marine metagenome] 45.4 0.013 ref|YP_003325625.1| cell division protein FtsX [Xylanimonas cell... 45.4 0.014 gb|ECN06645.1| hypothetical protein GOS_3910597 [marine metagenome] 45.4 0.014 ref|YP_002323470.1| protein of unknown function DUF214 [Bifidoba... 45.4 0.014 ref|NP_696351.1| FtsX-like protein [Bifidobacterium longum NCC27... 45.4 0.014 ref|YP_002277416.1| hypothetical protein Gdia_3071 [Gluconacetob... 45.4 0.014 ref|YP_003647954.1| hypothetical protein Tpau_3021 [Tsukamurella... 45.4 0.014 ref|YP_004415992.1| lipoprotein releasing system, transmembrane ... 45.4 0.014 ref|YP_002882775.1| protein of unknown function DUF214 [Beutenbe... 45.4 0.015 ref|YP_004220191.1| cell division protein [Bifidobacterium longu... 45.4 0.015 ref|YP_952741.1| hypothetical protein Mvan_1915 [Mycobacterium v... 45.4 0.015 ref|YP_003007165.1| outer membrane-specific lipoprotein transpor... 45.4 0.015 ref|ZP_02916855.1| hypothetical protein BIFDEN_00114 [Bifidobact... 45.4 0.016 ref|ZP_07468557.1| cell division protein FtsX [Corynebacterium a... 45.1 0.017 ref|ZP_07456768.1| cell division protein FtsX [Bifidobacterium d... 45.1 0.018 ref|YP_001603527.1| hypothetical protein GDI_3296 [Gluconacetoba... 45.1 0.018 ref|ZP_01870346.1| outer membrane-specific lipoprotein transport... 45.1 0.018 gb|ECG14298.1| hypothetical protein GOS_3460058 [marine metagenome] 45.1 0.020 gb|EBQ54503.1| hypothetical protein GOS_7734942 [marine metagenome] 45.1 0.020 ref|ZP_01821131.1| cell division ABC transporter, permease prote... 45.1 0.021 ref|NP_939122.1| putative cell division protein [Corynebacterium... 45.1 0.021 gb|EDE67715.1| hypothetical protein GOS_1089303 [marine metagenome] 45.1 0.021 ref|YP_428337.1| hypothetical protein Rru_A3255 [Rhodospirillum ... 45.1 0.021 ref|NP_856773.1| putative cell division protein FTSX (septation ... 45.1 0.021 ref|ZP_08035037.1| efflux ABC transporter, permease protein [Act... 44.7 0.022 gb|EFW50718.1| Lipoprotein releasing system transmembrane protei... 44.7 0.022 ref|ZP_04747298.1| cell division protein FtsX [Mycobacterium kan... 44.7 0.023 gb|EDE19961.1| hypothetical protein GOS_1172405 [marine metagenome] 44.7 0.023 ref|YP_004098541.1| hypothetical protein Intca_1296 [Intrasporan... 44.7 0.023 ref|YP_001831506.1| hypothetical protein Bind_0363 [Beijerinckia... 44.7 0.023 ref|ZP_06751929.1| putative cell division protein [Parascardovia... 44.7 0.024 ref|YP_001880712.1| outer membrane-specific lipoprotein transpor... 44.7 0.024 gb|EBF21726.1| hypothetical protein GOS_9633847 [marine metagenome] 44.7 0.025 gb|EBM33270.1| hypothetical protein GOS_8426774 [marine metagenome] 44.7 0.026 ref|YP_003543563.1| cell division protein [Sphingobium japonicum... 44.7 0.026 ref|YP_004593490.1| outer membrane-specific lipoprotein transpor... 44.7 0.026 ref|ZP_03917175.1| cell division protein [Corynebacterium glucur... 44.7 0.027 ref|YP_743953.1| cell division protein ftsX [Granulibacter bethe... 44.7 0.028 gb|ECR53178.1| hypothetical protein GOS_4798319 [marine metagenome] 44.7 0.028 ref|ZP_08612899.1| hypothetical protein HMPREF0991_02018 [Lachno... 44.3 0.028 ref|YP_003187546.1| cell division protein FtsX [Acetobacter past... 44.3 0.029 gb|ECX49768.1| hypothetical protein GOS_2527678 [marine metagenome] 44.3 0.030 ref|ZP_05364899.1| cell division protein FtsX [Corynebacterium t... 44.3 0.030 ref|ZP_02040179.1| hypothetical protein RUMGNA_00943 [Ruminococc... 44.3 0.030 ref|ZP_04447500.1| hypothetical protein BIFANG_02478 [Bifidobact... 44.3 0.031 ref|ZP_03051867.1| lipoprotein releasing system, transmembrane p... 44.3 0.031 ref|NP_301543.1| hypothetical protein ML0670 [Mycobacterium lepr... 44.3 0.032 ref|YP_004328184.1| efflux ABC transporter permease [Prevotella ... 44.3 0.033 ref|YP_003379633.1| hypothetical protein Kfla_1739 [Kribbella fl... 44.3 0.034 emb|CAB11001.1| hypothetical protein MLCB1779.20c [Mycobacterium... 44.3 0.034 gb|ECV48913.1| hypothetical protein GOS_2889260 [marine metagenome] 44.3 0.035 gb|EBM21099.1| hypothetical protein GOS_8445685 [marine metageno... 44.3 0.035 ref|YP_003916399.1| cell division membrane protein FtsX [Arthrob... 44.3 0.035 ref|ZP_07713600.1| probable cell division protein [Corynebacteri... 44.3 0.035 gb|ECV78101.1| hypothetical protein GOS_2836645 [marine metagenome] 44.3 0.036 gb|EBV87040.1| hypothetical protein GOS_6837754 [marine metagenome] 44.3 0.036 ref|ZP_02028321.1| hypothetical protein BIFADO_00747 [Bifidobact... 44.3 0.036 gb|ECI10099.1| hypothetical protein GOS_6149372 [marine metagenome] 43.9 0.037 ref|YP_003660811.1| hypothetical protein BLJ_0504 [Bifidobacteri... 43.9 0.038 ref|ZP_03976409.1| FtsX family protein involved in cell division... 43.9 0.038 gb|EDE43195.1| hypothetical protein GOS_1131810 [marine metagenome] 43.9 0.039 ref|YP_001704204.1| cell division protein FtsX-like protein [Myc... 43.9 0.039 ref|ZP_00121021.2| COG2177: Cell division protein [Bifidobacteri... 43.9 0.039 gb|EFE27822.1| lipoprotein [Filifactor alocis ATCC 35896] 43.9 0.039 ref|YP_909328.1| FtsX-like protein in cell division [Bifidobacte... 43.9 0.040 gb|EBW90392.1| hypothetical protein GOS_6673095 [marine metagenome] 43.9 0.042 ref|ZP_08127037.1| cell division protein FtsX [Actinomyces oris ... 43.9 0.044 ref|YP_002476154.1| outer membrane-specific lipoprotein transpor... 43.9 0.044 ref|YP_004255785.1| hypothetical protein Deipr_1012 [Deinococcus... 43.9 0.044 ref|ZP_08233037.1| cell division protein [Actinomyces viscosus C... 43.9 0.045 ref|ZP_03932992.1| cell division protein [Corynebacterium accole... 43.9 0.046 gb|ECH75515.1| hypothetical protein GOS_4005046 [marine metagenome] 43.9 0.048 ref|YP_003659033.1| hypothetical protein Srot_1742 [Segniliparus... 43.5 0.049 ref|YP_002908437.1| hypothetical protein bglu_2g07850 [Burkholde... 43.5 0.049 gb|EBT54611.1| hypothetical protein GOS_7255935 [marine metagenome] 43.5 0.049 gb|EBN14619.1| hypothetical protein GOS_8294385 [marine metagenome] 43.5 0.050 ref|YP_566547.1| hypothetical protein Mbur_1915 [Methanococcoide... 43.5 0.050 ref|ZP_08353189.1| lipoprotein releasing system, transmembrane p... 43.5 0.051 ref|YP_004467356.1| ABC transporter integral membrane subunit [A... 43.5 0.051 ref|YP_002803580.1| putative ABC transporter, permease protein [... 43.5 0.051 ref|ZP_06408918.1| membrane protein [Prevotella melaninogenica D... 43.5 0.051 ref|YP_001253746.1| ABC transporter permease [Clostridium botuli... 43.5 0.051 ref|ZP_02613310.1| putative ABC transporter, permease protein [C... 43.5 0.052 ref|YP_001390572.1| putative ABC transporter, permease protein [... 43.5 0.052 ref|YP_003855768.1| hypothetical protein PB2503_12944 [Parvularc... 43.5 0.053 ref|ZP_02782840.2| lipoprotein releasing system, transmembrane p... 43.5 0.053 ref|YP_001780846.1| putative ABC transporter, permease protein [... 43.5 0.053 ref|YP_001383580.1| putative ABC transporter, permease protein [... 43.5 0.053 ref|YP_310098.1| outer membrane-specific lipoprotein transporter... 43.5 0.055 ref|ZP_01050152.1| ABC transporter, permease protein [Dokdonia d... 43.5 0.055 gb|ECX51874.1| hypothetical protein GOS_2524073 [marine metagenome] 43.5 0.056 ref|NP_287252.1| outer membrane-specific lipoprotein transporter... 43.5 0.056 ref|NP_217617.1| putative cell division protein FTSX (septation ... 43.5 0.056 ref|ZP_04665394.1| cell division protein [Bifidobacterium longum... 43.5 0.057 ref|YP_403618.1| outer membrane-specific lipoprotein transporter... 43.5 0.057 ref|ZP_08303460.1| lipoprotein releasing system, transmembrane p... 43.5 0.058 ref|ZP_08383243.1| lipoprotein releasing system, transmembrane p... 43.5 0.058 gb|ECZ99888.1| hypothetical protein GOS_2082063 [marine metagenome] 43.5 0.058 gb|EDF37915.1| hypothetical protein GOS_965528 [marine metagenome] 43.5 0.059 gb|EBJ99231.1| hypothetical protein GOS_8806217 [marine metagenome] 43.5 0.059 ref|YP_001849837.1| cell division protein FtsX [Mycobacterium ma... 43.5 0.060 gb|EBV05171.1| hypothetical protein GOS_6964074 [marine metagenome] 43.5 0.061 ref|ZP_07658848.1| cell division protein FtsX [Roseibium sp. Tri... 43.5 0.061 ref|ZP_06550198.1| lipoprotein releasing system, transmembrane p... 43.5 0.061 ref|YP_002239261.1| lipoprotein releasing system, transmembrane ... 43.5 0.061 ref|ZP_01967732.1| hypothetical protein RUMTOR_01281 [Ruminococc... 43.5 0.061 ref|ZP_06646529.1| putative cell division ABC transporter, perme... 43.5 0.062 ref|YP_001328209.1| hypothetical protein Smed_2544 [Sinorhizobiu... 43.5 0.062 ref|ZP_06370147.1| protein of unknown function DUF214 [Desulfovi... 43.1 0.063 ref|YP_001334778.1| outer membrane-specific lipoprotein transpor... 43.1 0.063 gb|ECM22900.1| hypothetical protein GOS_3738709 [marine metagenome] 43.1 0.064 gb|ECD49632.1| hypothetical protein GOS_3228079 [marine metagenome] 43.1 0.064 gb|EBE11234.1| hypothetical protein GOS_9818692 [marine metagenome] 43.1 0.065 gb|EBS35452.1| hypothetical protein GOS_7450565 [marine metagenome] 43.1 0.067 gb|ECQ10901.1| hypothetical protein GOS_3448806 [marine metagenome] 43.1 0.068 gb|EBE45702.1| hypothetical protein GOS_9760720 [marine metagenome] 43.1 0.070 ref|ZP_07497109.1| outer membrane-specific lipoprotein transport... 43.1 0.071 ref|ZP_06661835.1| lipoprotein releasing system [Escherichia col... 43.1 0.071 ref|YP_002129472.1| cell division protein [Phenylobacterium zuci... 43.1 0.071 gb|ECW45422.1| hypothetical protein GOS_2718665 [marine metagenome] 43.1 0.072 gb|EBA92559.1| hypothetical protein GOS_318349 [marine metagenome] 43.1 0.072 ref|ZP_07960042.1| hypothetical protein HMPREF1026_01986 [Lachno... 43.1 0.072 gb|EDI27233.1| hypothetical protein GOS_460516 [marine metagenome] 43.1 0.073 ref|ZP_06016316.1| lipoprotein releasing system [Klebsiella pneu... 43.1 0.074 gb|EDG13790.1| hypothetical protein GOS_834011 [marine metagenome] 43.1 0.076 ref|YP_002386608.1| outer membrane-specific lipoprotein transpor... 43.1 0.076 ref|ZP_05043627.1| lipoprotein releasing system, transmembrane p... 43.1 0.076 gb|EFZ75744.1| lipoprotein releasing system, transmembrane prote... 43.1 0.077 gb|EBJ35245.1| hypothetical protein GOS_8912607 [marine metagenome] 43.1 0.079 ref|YP_001725441.1| outer membrane-specific lipoprotein transpor... 43.1 0.079 ref|ZP_05432491.1| outer membrane-specific lipoprotein transport... 43.1 0.082 ref|ZP_07448205.1| outer membrane-specific lipoprotein transport... 42.7 0.083 ref|ZP_05225376.1| efflux ABC transporter, permease protein [Myc... 42.7 0.083 ref|NP_415636.1| lipoprotein-releasing system transmembrane prot... 42.7 0.083 ref|YP_001744060.1| outer membrane-specific lipoprotein transpor... 42.7 0.084 ref|ZP_03071786.1| lipoprotein releasing system, transmembrane p... 42.7 0.085 ref|ZP_03065947.1| lipoprotein releasing system, transmembrane p... 42.7 0.085 gb|EGI94384.1| lipoprotein releasing system, transmembrane prote... 42.7 0.086 ref|ZP_04537377.1| outer membrane-specific lipoprotein transport... 42.7 0.086 gb|EGH39444.1| lipoprotein releasing system transmembrane protei... 42.7 0.086 ref|YP_003036690.1| outer membrane-specific lipoprotein transpor... 42.7 0.086 ref|ZP_06653060.1| lipoprotein releasing system [Escherichia col... 42.7 0.087 ref|YP_002402318.1| outer membrane-specific lipoprotein transpor... 42.7 0.087 ref|YP_002328760.1| outer membrane-specific lipoprotein transpor... 42.7 0.087 ref|YP_002382439.1| outer membrane-specific lipoprotein transpor... 42.7 0.088 ref|YP_540259.1| outer membrane-specific lipoprotein transporter... 42.7 0.088 ref|ZP_08616502.1| hypothetical protein HMPREF0988_02087 [Lachno... 42.7 0.089 gb|EFU46897.1| lipoprotein releasing system, transmembrane prote... 42.7 0.089 ref|YP_001684843.1| hypothetical protein Caul_3218 [Caulobacter ... 42.7 0.089 ref|YP_002397282.1| outer membrane-specific lipoprotein transpor... 42.7 0.090 ref|YP_002408009.1| outer membrane-specific lipoprotein transpor... 42.7 0.090 ref|NP_753302.1| outer membrane-specific lipoprotein transporter... 42.7 0.090 ref|ZP_03034584.1| lipoprotein releasing system, transmembrane p... 42.7 0.091 ref|ZP_06005434.1| conserved hypothetical protein [Prevotella be... 42.7 0.092 ref|ZP_05363679.1| cell division protein FtsX [Campylobacter sho... 42.7 0.094 ref|ZP_05283554.1| hypothetical protein Bfra3_19955 [Bacteroides... 42.7 0.095 gb|EBF15537.1| hypothetical protein GOS_9643869 [marine metagenome] 42.7 0.097 ref|YP_001404806.1| hypothetical protein Mboo_1646 [Candidatus M... 42.7 0.097 ref|ZP_08363452.1| lipoprotein releasing system, transmembrane p... 42.7 0.098 >ref|ZP_03063518.1| cell division protein FtsX [Shigella dysenteriae 1012] ref|ZP_04001413.1| cell division protein FtsX [Escherichia coli 83972] ref|ZP_07095558.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 107-1] 36 more sequence titles

ref|ZP_07102869.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 119-7] ref|ZP_07117140.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 198-1] ref|ZP_07125035.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 84-1] ref|ZP_07133886.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 115-1] ref|ZP_07151397.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 21-1] ref|ZP_07161033.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 116-1] ref|ZP_07169064.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 175-1] ref|ZP_07177343.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 45-1] ref|ZP_07178169.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 200-1] ref|ZP_07182927.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 69-1] ref|ZP_07208481.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 124-1] ref|ZP_07222522.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 78-1] ref|ZP_07245819.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 146-1] ref|ZP_07689164.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 145-7] gb|EDX36756.1| cell division protein FtsX [Shigella dysenteriae 1012] gb|EEJ49953.1| cell division protein FtsX [Escherichia coli 83972] gb|EFJ60749.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 200-1] gb|EFJ66220.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 175-1] gb|EFJ73391.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 198-1] gb|EFJ83206.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 69-1] gb|EFJ84434.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 84-1] gb|EFJ91655.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 45-1] gb|EFJ98853.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 115-1] gb|EFK17166.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 116-1] gb|EFK21892.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 21-1] gb|EFK45801.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 119-7] gb|EFK53287.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 107-1] gb|EFK70272.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 124-1] gb|EFK71896.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 78-1] gb|EFK90700.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 146-1] gb|EFO59054.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 145-7] gb|EFU36028.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 85-1] gb|EFU45565.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 110-3] gb|EFU55277.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 16-3] gb|EGB78569.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 57-2] gb|EGB87858.1| ABC transporter, FtsX cell division permease [Escherichia coli MS 117-3]

Length=357 Score = 719 bits (1855), Expect = 0.0, Method: Compositional matrix adjust. Identities = 352/352 (100%), Positives = 352/352 (100%), Gaps = 0/352 (0%) Query 1 MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAF 60 MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAF Sbjct 6 MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAF 65 Query 61 HGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLD 120 HGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLD Sbjct 66 HGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLD 125 Query 121 DDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKL 180 DDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKL Sbjct 126 DDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKL 185 Query 181 DFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI 240 DFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI Sbjct 186 DFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI 245 Query 241 GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSS 300 GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSS Sbjct 246 GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSS 305 Query 301 AVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE 352 AVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE Sbjct 306 AVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE 357 >ref|YP_859063.1| cell division protein FtsX [Escherichia coli APEC O1] ref|ZP_04533690.1| cell division protein ftsX [Escherichia sp. 3_2_53FAA] ref|ZP_04872686.1| cell division protein ftsX [Escherichia sp. 1_1_43] 17 more sequence titles Length=361 Score = 719 bits (1855), Expect = 0.0, Method: Compositional matrix adjust. Identities = 352/352 (100%), Positives = 352/352 (100%), Gaps = 0/352 (0%) Query 1 MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAF 60 MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAF Sbjct 10 MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAF 69 Query 61 HGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLD 120 HGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLD Sbjct 70 HGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLD 129 Query 121 DDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKL 180 DDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKL Sbjct 130 DDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKL 189 Query 181 DFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI 240 DFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI Sbjct 190 DFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI 249 Query 241 GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSS 300 GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSS Sbjct 250 GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSS 309 Query 301 AVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE 352 AVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE Sbjct 310 AVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE 361 >ref|NP_417919.1| predicted transporter subunit: membrane component of ABC superfamily [Escherichia coli str. K-12 substr. MG1655] ref|NP_839432.1| cell division protein FtsX [Shigella flexneri 2a str. 2457T] ref|NP_709232.2| cell division protein FtsX [Shigella flexneri 2a str. 301] 180 more sequence titles

ref|YP_405075.1| cell division protein FtsX [Shigella dysenteriae Sd197] ref|AP_004330.1| predicted transporter subunit [Escherichia coli str. K-12 substr. W3110] ref|YP_671432.1| cell division protein FtsX [Escherichia coli 536] ref|YP_690810.1| cell division protein FtsX [Shigella flexneri 5 str. 8401] ref|YP_001464927.1| cell division protein FtsX [Escherichia coli E24377A] ref|YP_001460257.1| cell division protein FtsX [Escherichia coli HS] ref|NP_756117.2| cell division protein FtsX [Escherichia coli CFT073] ref|YP_542937.2| cell division protein FtsX [Escherichia coli UTI89] ref|ZP_02772066.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC4113] ref|ZP_02778237.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC4401] ref|ZP_02790832.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC4486] ref|ZP_02797636.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC4196] ref|ZP_02804568.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC4076] ref|ZP_02810290.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC869] ref|ZP_02822255.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC508] ref|YP_001732296.1| ABC transporter membrane protein [Escherichia coli str. K-12 substr. DH10B] ref|YP_001745711.1| cell division protein FtsX [Escherichia coli SMS-3-5] ref|ZP_02999995.1| cell division protein FtsX [Escherichia coli 53638] ref|ZP_03031226.1| cell division protein FtsX [Escherichia coli B7A] ref|ZP_03031948.1| cell division protein FtsX [Escherichia coli F11] ref|ZP_03042921.1| cell division protein FtsX [Escherichia coli E22] ref|ZP_03059545.1| cell division protein FtsX [Escherichia coli B171] ref|ZP_03067693.1| cell division protein FtsX [Escherichia coli 101-1] ref|ZP_03080338.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC4024] ref|ZP_03248809.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC4206] ref|ZP_03253294.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC4045] ref|ZP_03260949.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC4042] ref|YP_002272906.1| cell division protein FtsX [Escherichia coli O157:H7 str. EC4115] ref|YP_002295005.1| cell division protein FtsX [Escherichia coli SE11] ref|YP_002331168.1| cell division protein FtsX [Escherichia coli O127:H6 str. E2348/69] ref|YP_002384515.1| cell division protein FtsX [Escherichia fergusonii ATCC 35469] ref|YP_002388926.1| cell division protein FtsX [Escherichia coli IAI1] ref|YP_002393443.1| cell division protein FtsX [Escherichia coli S88]